BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30024 (540 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0433 - 22891261-22891509,22892181-22892301,22892405-228924... 91 5e-19 04_04_0211 - 23636377-23636532,23636624-23636805,23637853-236379... 87 8e-18 02_02_0470 - 10700092-10700505 30 1.4 10_08_0951 - 21769342-21769752 29 3.1 03_01_0014 + 113638-113754,113836-113950,114570-114835,115365-11... 28 5.5 10_08_0026 - 14253680-14253894,14253981-14254109,14254704-142547... 27 7.2 08_02_1540 + 27694565-27694579,27696364-27696447,27696599-276967... 27 9.6 07_01_0555 - 4125087-4125578 27 9.6 >02_04_0433 - 22891261-22891509,22892181-22892301,22892405-22892496, 22892692-22892755,22892855-22892920,22893102-22893193, 22893991-22894050,22894181-22894270,22894484-22894613, 22895066-22895157,22895299-22895373,22895663-22895754, 22896496-22896586,22897541-22897574,22897745-22897791, 22899110-22899209,22899300-22899436,22900837-22901015, 22901146-22901188,22901264-22901297,22901839-22901948, 22902043-22902224,22903062-22903168,22903266-22903480 Length = 833 Score = 91.1 bits (216), Expect = 5e-19 Identities = 51/102 (50%), Positives = 69/102 (67%), Gaps = 5/102 (4%) Frame = +3 Query: 216 PSIQQACTQDPTQLKI----GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPL 383 PS ++A +PT+L+ GTV ILLAGR+ GKRVV + L SGLLL+TGPF N P+ Sbjct: 61 PSTRKA---NPTKLRSTITPGTVLILLAGRYMGKRVVFLKQLKSGLLLITGPFKINGVPI 117 Query: 384 RRIPQRYVIGTSTRISLGNFKLPKHFNDDYFKKNKKC-VKRT 506 RR+ Q YVI TST++ + K+ K F+D YF ++KK K+T Sbjct: 118 RRVNQAYVIATSTKVDISGVKVDK-FDDKYFARDKKAKAKKT 158 >04_04_0211 - 23636377-23636532,23636624-23636805,23637853-23637959, 23637997-23638280 Length = 242 Score = 87.0 bits (206), Expect = 8e-18 Identities = 43/76 (56%), Positives = 53/76 (69%) Frame = +3 Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443 GTV ILLAGR GKRVV + L SGLLLVTGPF N P+RR+ Q YVI TST++ + Sbjct: 101 GTVLILLAGRFMGKRVVFLKQLKSGLLLVTGPFKINGVPIRRVNQPYVIATSTKVDISGV 160 Query: 444 KLPKHFNDDYFKKNKK 491 + K F+D YF ++KK Sbjct: 161 NVEK-FDDKYFSRDKK 175 >02_02_0470 - 10700092-10700505 Length = 137 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSG 338 LK G ILL GR+AG++ V+V + G Sbjct: 5 LKPGKAVILLQGRYAGRKAVIVRVFEEG 32 >10_08_0951 - 21769342-21769752 Length = 136 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSG 338 LK G ILL GR AG++ V+V + G Sbjct: 5 LKPGKAVILLQGRFAGRKAVIVRVFEEG 32 >03_01_0014 + 113638-113754,113836-113950,114570-114835,115365-115575, 115915-115979,118723-118930,119457-119566,119663-119913, 120250-120356,120442-120509,120624-120701,121070-121198, 121341-121481,122297-122344,122648-122743,124071-124183, 124441-124591,124745-124818,124913-125072,125356-125454, 125532-125618,125761-125907 Length = 946 Score = 27.9 bits (59), Expect = 5.5 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +3 Query: 174 LLPHSGENPCFIWWPSIQQACTQDPTQLKIGTVC-ILLAGRH 296 +LP S E P W + ACT DP + G C +L GR+ Sbjct: 51 VLPESYEPPADEPWTTGIFACTDDPQTCRTGLFCPCVLFGRN 92 >10_08_0026 - 14253680-14253894,14253981-14254109,14254704-14254769, 14254887-14255133 Length = 218 Score = 27.5 bits (58), Expect = 7.2 Identities = 19/75 (25%), Positives = 34/75 (45%) Frame = +2 Query: 182 PLRRKSVLHLVAVHSASMYAGSDPTEDRNCLHSPRW*TCRQEGCTCWNSAQRSAFSYWTF 361 PL + L+AV +A++ AG+ + H R Q G ++ + + W+ Sbjct: 9 PLLLVAAAALIAVVTATVAAGAGEGPACDTAHCGRGQCVEQPGPLGLDTFRCDCDAGWSN 68 Query: 362 CFQFVPATPYSSALC 406 F F+PA+P + C Sbjct: 69 MFAFLPASPCTIPKC 83 >08_02_1540 + 27694565-27694579,27696364-27696447,27696599-27696731, 27696840-27696951,27697530-27697629,27697810-27697937, 27698046-27698115,27698548-27698636,27698719-27698764, 27698854-27698924,27699002-27699075,27699341-27699433, 27699539-27699572,27699704-27699789,27702147-27702223, 27702445-27702533,27702630-27702813,27703068-27703249, 27703962-27704064,27704159-27704490,27704577-27705018, 27705749-27705846,27706988-27707081,27707666-27707787, 27708025-27708078,27708185-27708304,27708595-27708799, 27708889-27709059,27709155-27709310,27709375-27709431, 27709474-27709580,27709708-27709798,27709931-27710072, 27710149-27710305,27710400-27710516,27710596-27710722, 27710844-27711066,27711460-27711466,27711656-27711788 Length = 1574 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/35 (31%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +3 Query: 120 WR*EEWGNQNSTPQT*EV--LLPHSGENPCFIWWP 218 W+ E Q+++P ++ L H+G+ C +WWP Sbjct: 86 WKIPELHGQSNSPPLEQLFTLDEHTGKIRCVLWWP 120 >07_01_0555 - 4125087-4125578 Length = 163 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +3 Query: 249 TQLKIGTVCILLAGRHAGKRVVLVGILPSGLL--LVTGPFA 365 T L + T LA RH+ K VVL+ ++P L+ ++T F+ Sbjct: 123 TGLILATTATWLARRHSAKVVVLLALVPQVLVAGVITSTFS 163 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,306,413 Number of Sequences: 37544 Number of extensions: 331075 Number of successful extensions: 787 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 787 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1198356516 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -