BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30019 (719 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g31850.3 68414.m03915 dehydration-responsive protein, putativ... 29 4.1 At1g31850.2 68414.m03914 dehydration-responsive protein, putativ... 29 4.1 At1g31850.1 68414.m03913 dehydration-responsive protein, putativ... 29 4.1 At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) fa... 27 9.5 At2g43560.1 68415.m05412 immunophilin / FKBP-type peptidyl-proly... 27 9.5 >At1g31850.3 68414.m03915 dehydration-responsive protein, putative strong similarity to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 603 Score = 28.7 bits (61), Expect = 4.1 Identities = 16/50 (32%), Positives = 20/50 (40%) Frame = +3 Query: 186 PRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQNIVRHD 335 P PC V P G S+P P H +P R S N ++HD Sbjct: 383 PLRPCVVAPTPKVKKSGLGSIPKWPERLHVAPERIGDVHG-GSANSLKHD 431 >At1g31850.2 68414.m03914 dehydration-responsive protein, putative strong similarity to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 603 Score = 28.7 bits (61), Expect = 4.1 Identities = 16/50 (32%), Positives = 20/50 (40%) Frame = +3 Query: 186 PRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQNIVRHD 335 P PC V P G S+P P H +P R S N ++HD Sbjct: 383 PLRPCVVAPTPKVKKSGLGSIPKWPERLHVAPERIGDVHG-GSANSLKHD 431 >At1g31850.1 68414.m03913 dehydration-responsive protein, putative strong similarity to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 603 Score = 28.7 bits (61), Expect = 4.1 Identities = 16/50 (32%), Positives = 20/50 (40%) Frame = +3 Query: 186 PRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSSQNIVRHD 335 P PC V P G S+P P H +P R S N ++HD Sbjct: 383 PLRPCVVAPTPKVKKSGLGSIPKWPERLHVAPERIGDVHG-GSANSLKHD 431 >At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) family protein contains a Prosite:PS00518 Zinc finger, C3HC4 type (RING finger), signature Length = 348 Score = 27.5 bits (58), Expect = 9.5 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +3 Query: 150 RCQARCCYPCSLPRGPCS-VPGRPSCLPRGPCSVPGAPV 263 RC + CY C + G C G P P P S P PV Sbjct: 283 RCGHKFCYRCGVQAGGCKHGHGLPPRPPPPPPSPPPTPV 321 >At2g43560.1 68415.m05412 immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase family protein identical to Probable FKBP-type peptidyl-prolyl cis-trans isomerase 2, chloroplast precursor (Ppiase) (Rotamase) (SP:O22870)[Arabidopsis thaliana]; contains Pfam PF00254: peptidyl-prolyl cis-trans isomerase, FKBP-type Length = 223 Score = 27.5 bits (58), Expect = 9.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 174 PCSLPRGPCSVPGRPSCLPRGP 239 P + P+G S PGRP P P Sbjct: 184 PLAFPKGLVSAPGRPRVAPNSP 205 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,151,069 Number of Sequences: 28952 Number of extensions: 224483 Number of successful extensions: 651 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -