BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30014 (611 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) 147 5e-36 SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) 144 4e-35 SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) 122 3e-28 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 105 2e-23 SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 8e-22 SB_37014| Best HMM Match : HSP70 (HMM E-Value=5.9e-16) 38 0.008 SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) 34 0.10 SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) 34 0.10 SB_26267| Best HMM Match : TSP_C (HMM E-Value=0) 30 1.3 SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10) 30 1.3 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 29 2.2 SB_29552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_2785| Best HMM Match : ATP-synt_F (HMM E-Value=0.15) 29 2.2 SB_51308| Best HMM Match : ATP-synt_F (HMM E-Value=0.14) 29 2.2 SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_34145| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_48890| Best HMM Match : DUF560 (HMM E-Value=5.2) 29 3.0 SB_13937| Best HMM Match : zf-CCCH (HMM E-Value=0.0017) 29 3.0 SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) 29 3.9 SB_5639| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_37567| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0) 28 6.9 SB_35714| Best HMM Match : Vicilin_N (HMM E-Value=5) 27 9.1 >SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1097 Score = 147 bits (357), Expect = 5e-36 Identities = 78/142 (54%), Positives = 98/142 (69%) Frame = +2 Query: 47 YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226 YSDNQPGVLIQVFEGER+MT NNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA Sbjct: 433 YSDNQPGVLIQVFEGERSMTAHNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 492 Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406 ++KST KEN+ + K ++ + + +Q++ IQ + + S Sbjct: 493 VDKSTGKENKITITNDKGRLSKEDIERMVNEASKYKEEDEKQRDRIQTKNSLESYAYSM- 551 Query: 407 SATMEDEKLKEKILLNSDKQTI 472 +T+ED+K+K+KI DK+ I Sbjct: 552 KSTVEDDKVKDKI-SEEDKKAI 572 >SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 144 bits (350), Expect = 4e-35 Identities = 74/148 (50%), Positives = 99/148 (66%) Frame = +2 Query: 47 YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226 YSDNQ VLIQV+EGER++TKDNNLLGKFEL+GIPPAPRGVPQI+VTFD+D+NGILNVSA Sbjct: 525 YSDNQTSVLIQVYEGERSLTKDNNLLGKFELSGIPPAPRGVPQIDVTFDVDSNGILNVSA 584 Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406 ++KST KEN+ + K ++ + + +E IQ + + S Sbjct: 585 VDKSTGKENKITITNDKGRLSKEDIERMVKEAEKFKAADEAVRERIQSKNSLESYAFSM- 643 Query: 407 SATMEDEKLKEKILLNSDKQTIPRTSAT 490 +TMEDEK+K+K+ + ++ I R AT Sbjct: 644 KSTMEDEKVKDKLSEDEREKVISRCKAT 671 >SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) Length = 640 Score = 122 bits (293), Expect = 3e-28 Identities = 69/142 (48%), Positives = 87/142 (61%) Frame = +2 Query: 47 YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226 YSDNQP V I+VFEGER +TK NNLLGKF+L+GIPPAPRGVPQIEVTFDIDANGILNVSA Sbjct: 432 YSDNQPAVTIRVFEGERPLTKHNNLLGKFDLSGIPPAPRGVPQIEVTFDIDANGILNVSA 491 Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406 +KST K + K ++ + ++ Q+E I + + Sbjct: 492 KDKSTGKTGSITITNDKGRLSKEEIDRMINDAEKYKSEDEAQREKIAARNRLESYAFGVK 551 Query: 407 SATMEDEKLKEKILLNSDKQTI 472 SA + + L+ K L SDK T+ Sbjct: 552 SA-ISEPSLEGK-LSQSDKDTV 571 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 105 bits (253), Expect = 2e-23 Identities = 65/142 (45%), Positives = 85/142 (59%), Gaps = 1/142 (0%) Frame = +2 Query: 50 SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229 +DNQ V IQVFEGER MTKDN+ LGKF+L GIPPAPRGVPQIEVTF+ID NGIL VSA Sbjct: 1127 ADNQNTVTIQVFEGERPMTKDNHPLGKFDLNGIPPAPRGVPQIEVTFEIDVNGILRVSAE 1186 Query: 230 EKST-NKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406 +K T NKE + ++P + ++ + + KE ++ + + S Sbjct: 1187 DKGTGNKEKITITNDQNRLTPEDIERMVNDAEKFAD-EDKKTKEKVEARNELESYAYSLK 1245 Query: 407 SATMEDEKLKEKILLNSDKQTI 472 + + EKL K L DK+TI Sbjct: 1246 NQVGDKEKLGGK-LSEDDKKTI 1266 >SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 100 bits (240), Expect = 8e-22 Identities = 46/69 (66%), Positives = 56/69 (81%) Frame = +2 Query: 50 SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229 +D Q V I+VF+GER M DN LLG+F+L GIPPAPRGVPQ+EVTFDIDANGI+NVSA Sbjct: 238 ADGQTQVEIKVFQGEREMAIDNKLLGQFQLVGIPPAPRGVPQVEVTFDIDANGIVNVSAR 297 Query: 230 EKSTNKENR 256 +K T +E + Sbjct: 298 DKGTGREQQ 306 Score = 35.1 bits (77), Expect = 0.045 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +1 Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354 EQ + G LSK+ IE M+ EAEKY D + K Sbjct: 304 EQQIVIQSSGGLSKDAIENMIKEAEKYAEADKQKK 338 >SB_37014| Best HMM Match : HSP70 (HMM E-Value=5.9e-16) Length = 212 Score = 37.5 bits (83), Expect = 0.008 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = +2 Query: 50 SDNQPGVLIQVFEGERAMTKDNNLLGKFEL 139 +D Q V I+VF+GER M DN LLG+F+L Sbjct: 183 ADGQTQVEIKVFQGEREMAIDNKLLGQFQL 212 >SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) Length = 348 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = +1 Query: 229 REVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNE 339 +E+ + EQ+T D G + EE++R+ NE EK +NE Sbjct: 118 KEIVKLREQLTSKADYGNIHAEELQRIRNELEKCKNE 154 >SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) Length = 364 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = +1 Query: 229 REVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNE 339 +E+ + EQ+T D G + EE++R+ NE EK +NE Sbjct: 118 KEIVKLREQLTSKADYGNIHAEELQRIRNELEKCKNE 154 >SB_26267| Best HMM Match : TSP_C (HMM E-Value=0) Length = 2996 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 225 LSRSPPTRRTDHHYQRQRS 281 LSR P R DHHY RQRS Sbjct: 2108 LSRVTPLFRPDHHYNRQRS 2126 >SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10) Length = 783 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +1 Query: 211 PQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDK 348 P + +++ QQ EQ+ + ++ R ++EE R EAE R E D+ Sbjct: 425 PNKALVKQMQQQLEQLKLEEERQRQAEEEKIRQREEAEARRLEKDR 470 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = +1 Query: 226 YREVHQQGEQITITNDKGRLSKEEIERMVNEAE-KYRNEDDKAKG 357 Y + +Q +I + N+ + SKE++ER V AE + R+ D + KG Sbjct: 1030 YDKTRRQLNKILVENENLKGSKEDLERRVVVAENRLRDTDSEMKG 1074 >SB_29552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 339 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/57 (24%), Positives = 31/57 (54%) Frame = +2 Query: 80 VFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKE 250 +FE ++ + + + G EL PPA V ++E +F+ +G+++ + S+ +E Sbjct: 125 IFEPRESVPRQSQVPGAMELLPPPPAVFNVNEVETSFEELKSGLMSSGNSDMSSLEE 181 >SB_2785| Best HMM Match : ATP-synt_F (HMM E-Value=0.15) Length = 379 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +1 Query: 277 GRLSKEEIERMVNEAEKYRNEDDKAKGDH-PGPRMHWNLTGFSMK 408 GR+S EE ++ E E+Y D + H P PR + G S+K Sbjct: 313 GRISDEEFRLILKEQERYNTLKDAIRARHGPAPRDEKSGKGPSLK 357 >SB_51308| Best HMM Match : ATP-synt_F (HMM E-Value=0.14) Length = 246 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +1 Query: 277 GRLSKEEIERMVNEAEKYRNEDDKAKGDH-PGPRMHWNLTGFSMK 408 GR+S EE ++ E E+Y D + H P PR + G S+K Sbjct: 157 GRISDEEFRLILQEQERYNTLKDAIRARHGPAPRDEKSGKGPSLK 201 >SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1353 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 290 RKRSSVWLMRQRSTETRMTRQKETIQGQECIGIL 391 R+ W R +ST TR K +QG +CI +L Sbjct: 1120 RRDGYTWKKRTKSTTTREDHFKLKVQGIDCISVL 1153 >SB_34145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 679 Score = 29.5 bits (63), Expect = 2.2 Identities = 22/75 (29%), Positives = 36/75 (48%) Frame = +2 Query: 131 FELTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSVW 310 FE+ GI P + + + D +N NVS+ EKS + + P TT + ++RS Sbjct: 157 FEMLGISPEKKD----KDSDDSSSNSNTNVSSDEKSPKADRKRP-KTTSLDELKRRSKKT 211 Query: 311 LMRQRSTETRMTRQK 355 +R T + TR + Sbjct: 212 RSPERRTMSAKTRSQ 226 >SB_48890| Best HMM Match : DUF560 (HMM E-Value=5.2) Length = 122 Score = 29.1 bits (62), Expect = 3.0 Identities = 26/93 (27%), Positives = 37/93 (39%) Frame = +3 Query: 231 RSPPTRRTDHHYQRQRSSLQGRDRAYG**GREVQKRG*QGKRRPSRAKNALESYWLQHEV 410 +S RRTD + Q+ R G+D GR G K+ P + WL H+ Sbjct: 18 KSGNARRTDRNSQKDRGIDDGKDEEDR--GRPPSSGGCTKKKSPDKR------SWLYHKS 69 Query: 411 LPWRMRSSRKRFS*TLTSRPFLEQVQHPPIQVD 509 L +R + R + T RP + P VD Sbjct: 70 LCDTLRILKTRSNLTWNKRPGMYMFDEPNDAVD 102 >SB_13937| Best HMM Match : zf-CCCH (HMM E-Value=0.0017) Length = 1495 Score = 29.1 bits (62), Expect = 3.0 Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Frame = +1 Query: 187 LRHRCQRYPQRFRY-REVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDH 363 L+ R +R +++ + RE + D GR ++EE ER + + +E D++ G+ Sbjct: 941 LKPREEREKEQYEHTRETARSDYPTDRYPDDGRYTREEWERQEEDWRQRWDEWDRSTGER 1000 Query: 364 PGPRMHWNLTG 396 P +W+ G Sbjct: 1001 GPPPPYWDEHG 1011 >SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) Length = 185 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 158 PRGVPQIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTK 277 P GV + ++ I +G+L+V A++KS + P TK Sbjct: 56 PEGVDESSISTRIAEDGMLHVEALKKSPPATTENKAPATK 95 >SB_5639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1384 Score = 28.3 bits (60), Expect = 5.2 Identities = 22/71 (30%), Positives = 31/71 (43%) Frame = -2 Query: 214 EDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVGGEC 35 ED VGID EG+L++R R Q + T + TLK L + ++ G+ Sbjct: 402 EDDVGIDDEGNLHIRSVGRFNEGTYQCKATRLAGASSTAAFTLKILALNTPTILSAKGKA 461 Query: 34 LSLFSGDGSVT 2 S D VT Sbjct: 462 -SFGPRDADVT 471 >SB_37567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 278 Score = 28.3 bits (60), Expect = 5.2 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = -3 Query: 159 GAGGIPVSSNLPSKLLSLVIARSPSNTWM 73 G GG PV+S SKL++ VIA SN+++ Sbjct: 21 GRGGSPVTSRPGSKLINHVIASFQSNSFI 49 >SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0) Length = 1066 Score = 27.9 bits (59), Expect = 6.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 9 LPSPLNRLRHSPPTLITNP 65 LP N + H+PPT + NP Sbjct: 760 LPDTANEIEHAPPTTVINP 778 >SB_35714| Best HMM Match : Vicilin_N (HMM E-Value=5) Length = 288 Score = 27.5 bits (58), Expect = 9.1 Identities = 25/77 (32%), Positives = 36/77 (46%), Gaps = 7/77 (9%) Frame = +1 Query: 157 AAWRASN*GHLRHRCQ-----RYPQRFRYREVHQQGEQITITNDKGRLSKE-EIERMVNE 318 A +RA GH+ R Q R P + REV +QGE + D L+ E E E + + Sbjct: 156 ACFRAGLRGHVHPRPQEGTDVRLPLQLHQREVRRQGEARLLFTDTDSLTYEIETEDVYQD 215 Query: 319 AEKYRNEDDKA-KGDHP 366 + NE D+ D+P Sbjct: 216 ---FWNEKDRLDNSDYP 229 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,781,867 Number of Sequences: 59808 Number of extensions: 464101 Number of successful extensions: 1518 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 1401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1507 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -