BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30011 (766 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 2.4 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 22 5.4 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 5.4 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 9.5 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 23.4 bits (48), Expect = 2.4 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 5/49 (10%) Frame = +2 Query: 206 DSTIEPQILH*KNSMSMGRNCRCSCNERPKNQ-----EIKRIWIYYIFS 337 DS IEP+I +NS+S G + E P ++ R + YY++S Sbjct: 293 DSPIEPEIEISQNSVSTGSDKENHKTEEPNDEVATYDNTPRDFPYYMYS 341 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 614 HNHQTLQNQSPFSFLFLYLSQH*QKQY 534 H+HQ L QSP+ +Y + +K+Y Sbjct: 77 HHHQVLYQQSPY---LMYENPDEEKRY 100 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 582 LFFPVSLSVTTLTETIFPNV 523 +F PVS TT+ I+P V Sbjct: 829 MFLPVSYMSTTMAGVIYPPV 848 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.4 bits (43), Expect = 9.5 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -1 Query: 727 NHYPRPDMSVFGYWL 683 NH P+++V+G W+ Sbjct: 579 NHSCDPNLAVYGVWI 593 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,802 Number of Sequences: 438 Number of extensions: 3675 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -