BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30011 (766 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 68 8e-12 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 66 2e-11 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 65 4e-11 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 65 4e-11 At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 65 6e-11 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 65 6e-11 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 62 4e-10 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 62 4e-10 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 62 4e-10 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 62 5e-10 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 61 9e-10 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 61 9e-10 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 60 2e-09 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 60 2e-09 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 59 3e-09 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 56 2e-08 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 53 2e-07 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 53 2e-07 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 51 7e-07 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 51 7e-07 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 51 7e-07 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 50 2e-06 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 50 2e-06 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 50 2e-06 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 50 2e-06 At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ... 49 3e-06 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 49 3e-06 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 49 4e-06 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 48 9e-06 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 47 1e-05 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 47 2e-05 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 46 4e-05 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 46 4e-05 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 46 4e-05 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 45 5e-05 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 45 5e-05 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 45 6e-05 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 45 6e-05 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 44 8e-05 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 44 8e-05 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 44 8e-05 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 44 8e-05 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 44 8e-05 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 44 8e-05 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 44 8e-05 At2g21690.1 68415.m02580 RNA-binding protein, putative similar t... 44 1e-04 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 44 1e-04 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 44 1e-04 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 43 2e-04 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 43 2e-04 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 43 2e-04 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 43 2e-04 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 43 2e-04 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 43 3e-04 At1g71800.1 68414.m08298 cleavage stimulation factor, putative s... 43 3e-04 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 42 3e-04 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 42 3e-04 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 42 4e-04 At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ... 42 6e-04 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 42 6e-04 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 41 0.001 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 40 0.001 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 40 0.001 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 40 0.001 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 40 0.001 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 40 0.001 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 40 0.001 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 40 0.001 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 40 0.001 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 40 0.001 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 40 0.002 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 40 0.002 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 40 0.002 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 40 0.002 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 39 0.003 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 39 0.003 At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ... 39 0.003 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 39 0.003 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 39 0.003 At5g51300.2 68418.m06360 splicing factor-related contains simila... 39 0.004 At5g51300.1 68418.m06359 splicing factor-related contains simila... 39 0.004 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 39 0.004 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 39 0.004 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 39 0.004 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 39 0.004 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 38 0.006 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 38 0.006 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 38 0.006 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 38 0.006 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 38 0.006 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 38 0.007 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 38 0.007 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 38 0.007 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 38 0.010 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 38 0.010 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 38 0.010 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 38 0.010 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 38 0.010 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 38 0.010 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 37 0.013 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 37 0.013 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 37 0.013 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 37 0.013 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 37 0.013 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 37 0.013 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 37 0.017 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 37 0.017 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 36 0.022 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 36 0.022 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 36 0.022 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 36 0.039 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 36 0.039 At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3... 36 0.039 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 36 0.039 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 36 0.039 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 36 0.039 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 36 0.039 At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, pu... 36 0.039 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 35 0.052 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 35 0.052 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 35 0.052 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 35 0.052 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 35 0.052 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 35 0.052 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 35 0.052 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 35 0.068 At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28... 35 0.068 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 35 0.068 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 35 0.068 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 35 0.068 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 35 0.068 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 35 0.068 At5g65260.1 68418.m08209 polyadenylate-binding protein family pr... 34 0.090 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 34 0.12 At5g41690.1 68418.m05067 polyadenylate-binding protein, putative... 33 0.16 At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing ... 33 0.16 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 33 0.16 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 33 0.16 At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing ... 33 0.16 At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing ... 33 0.21 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 33 0.28 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 32 0.36 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 32 0.36 At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing ... 32 0.36 At5g51120.1 68418.m06339 polyadenylate-binding protein, putative... 32 0.48 At1g45100.1 68414.m05170 polyadenylate-binding protein, putative... 32 0.48 At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing ... 31 0.64 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 31 0.64 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 31 0.64 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 31 0.84 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 31 0.84 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 31 0.84 At2g39090.1 68415.m04803 tetratricopeptide repeat (TPR)-containi... 31 0.84 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 31 0.84 At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing ... 31 0.84 At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing ... 31 1.1 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 31 1.1 At5g10350.2 68418.m01201 polyadenylate-binding protein family pr... 30 1.5 At5g10350.1 68418.m01200 polyadenylate-binding protein family pr... 30 1.5 At5g09830.1 68418.m01137 BolA-like family protein contains Pfam ... 30 1.5 At2g47310.1 68415.m05906 flowering time control protein-related ... 30 1.5 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 30 1.5 At5g13010.1 68418.m01491 RNA helicase, putative similar to DEAH-... 29 2.6 At3g10845.1 68416.m01306 RNA recognition motif (RRM)-containing ... 29 3.4 At1g72800.1 68414.m08416 nuM1-related contains similarity with n... 29 3.4 At1g41855.1 68414.m04833 hypothetical protein 29 3.4 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 29 4.5 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 29 4.5 At4g38440.1 68417.m05432 expressed protein 28 5.9 At4g30150.1 68417.m04287 expressed protein 28 5.9 At1g56660.1 68414.m06516 expressed protein 28 5.9 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 28 5.9 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 28 5.9 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 28 5.9 At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu... 28 7.8 At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonu... 28 7.8 At1g79100.1 68414.m09223 arginine/serine-rich protein-related si... 28 7.8 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 67.7 bits (158), Expect = 8e-12 Identities = 34/87 (39%), Positives = 56/87 (64%), Gaps = 1/87 (1%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPREEI 431 +GEI D V+MKD KT + +GFGF+TY+ + +VD+ Q+N H I G+ VE KR +PR + Sbjct: 65 YGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKVIQDN--HIIIGKQVEIKRTIPRGSM 122 Query: 432 KRPEASATVKKLFVAGLKQDIEEEDLE 512 + KK+FV G+ +++++ + Sbjct: 123 SSNDFK--TKKIFVGGIPSSVDDDEFK 147 Score = 49.6 bits (113), Expect = 2e-06 Identities = 30/74 (40%), Positives = 43/74 (58%), Gaps = 2/74 (2%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE--AQNNRPHKIDGRIVEPKRAVPREE 428 +GE+ + +M+D T RS+GFGF+TY MVD A+ NR ++ G VE K+A P Sbjct: 153 FGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKGNR-IELSGTQVEIKKAEP--- 208 Query: 429 IKRPEASATVKKLF 470 K+P + T K F Sbjct: 209 -KKPNSVTTPSKRF 221 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/48 (41%), Positives = 31/48 (64%) Frame = +2 Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 ++F +G I ++ D++TG+ RGFGFV + D VD+V +Q NH I Sbjct: 60 KHFGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKV-IQDNHII 106 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/46 (36%), Positives = 27/46 (58%) Frame = +2 Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 +E+F FG + ++ D TG+ RGFGFV ++ D VD + + N Sbjct: 147 KEFFMQFGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKGN 192 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 66.1 bits (154), Expect = 2e-11 Identities = 33/94 (35%), Positives = 54/94 (57%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413 +K + +G++ D +VMKD T RS+GFG++T++ A A H + RI+E K A Sbjct: 19 LKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNALKGE-HFLGNRILEVKVA 77 Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLES 515 P+EE+++P T ++FVA + + E D S Sbjct: 78 TPKEEMRQPAKKVT--RIFVARIPSSVSESDFRS 109 Score = 47.6 bits (108), Expect = 9e-06 Identities = 23/62 (37%), Positives = 36/62 (58%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434 +GEI D+ + KD +K+ +G GFIT+S A V++ + H + G V RA P+E+ Sbjct: 114 YGEITDLYMPKDYNSKQHRGIGFITFSSADSVEDLMED-THDLGGTTVAVDRATPKEDDH 172 Query: 435 RP 440 P Sbjct: 173 PP 174 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/67 (35%), Positives = 36/67 (53%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434 +G I D + KDPK +GFGF+T+++ + D R H+I G+ V A P +E Sbjct: 263 FGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRVA-RRSHEICGQEVAIDSATPLDE-A 320 Query: 435 RPEASAT 455 P A A+ Sbjct: 321 GPSAGAS 327 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 LR+YF FG+I + D + RGFGFV F + DRV +++H+I Sbjct: 256 LRDYFGRFGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRVA-RRSHEI 304 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/33 (45%), Positives = 23/33 (69%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 L++Y S FG++ V+ D+ TG+ RGFG+V F Sbjct: 19 LKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTF 51 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 65.3 bits (152), Expect = 4e-11 Identities = 35/106 (33%), Positives = 60/106 (56%), Gaps = 12/106 (11%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413 +K ++GE+++ V++KD T R++GFGF+ ++ V E H IDGR+VE K+A Sbjct: 22 LKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKA 80 Query: 414 VPREE---IKRPEASA---------TVKKLFVAGLKQDIEEEDLES 515 VPR++ + R +S+ +K+FV GL + E D ++ Sbjct: 81 VPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKT 126 Score = 60.1 bits (139), Expect = 2e-09 Identities = 29/65 (44%), Positives = 40/65 (61%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434 +G DVVVM D T+R +GFGFITY V++ H+++G++VE KRAVP+E Sbjct: 131 FGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPKELSP 190 Query: 435 RPEAS 449 P S Sbjct: 191 GPSRS 195 Score = 52.0 bits (119), Expect = 4e-07 Identities = 22/51 (43%), Positives = 33/51 (64%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 RL+EYFS+FG ++ ++ D+ TG+ RGFGFV F D V + + + H I Sbjct: 21 RLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFAD-PAVAEIVITEKHNI 70 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/49 (36%), Positives = 29/49 (59%) Frame = +2 Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 + YF FG V V+ D T + RGFGF+ +D + V++V L+ H++ Sbjct: 125 KTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHEL 173 Score = 31.9 bits (69), Expect = 0.48 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 175 PEHTRKLFIGGLDYRTTDSSLKEFYE 252 P TRK+F+GGL T+S K ++E Sbjct: 104 PGRTRKIFVGGLPSSVTESDFKTYFE 129 Score = 27.9 bits (59), Expect = 7.8 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 190 KLFIGGLDYRTTDSSLKEFY 249 KLFIGG+ + T + LKE++ Sbjct: 7 KLFIGGISWDTNEERLKEYF 26 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 65.3 bits (152), Expect = 4e-11 Identities = 35/106 (33%), Positives = 60/106 (56%), Gaps = 12/106 (11%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413 +K ++GE+++ V++KD T R++GFGF+ ++ V E H IDGR+VE K+A Sbjct: 22 LKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKA 80 Query: 414 VPREE---IKRPEASA---------TVKKLFVAGLKQDIEEEDLES 515 VPR++ + R +S+ +K+FV GL + E D ++ Sbjct: 81 VPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKT 126 Score = 60.1 bits (139), Expect = 2e-09 Identities = 29/65 (44%), Positives = 40/65 (61%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434 +G DVVVM D T+R +GFGFITY V++ H+++G++VE KRAVP+E Sbjct: 131 FGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPKELSP 190 Query: 435 RPEAS 449 P S Sbjct: 191 GPSRS 195 Score = 52.0 bits (119), Expect = 4e-07 Identities = 22/51 (43%), Positives = 33/51 (64%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 RL+EYFS+FG ++ ++ D+ TG+ RGFGFV F D V + + + H I Sbjct: 21 RLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFAD-PAVAEIVITEKHNI 70 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/49 (36%), Positives = 29/49 (59%) Frame = +2 Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 + YF FG V V+ D T + RGFGF+ +D + V++V L+ H++ Sbjct: 125 KTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHEL 173 Score = 31.9 bits (69), Expect = 0.48 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 175 PEHTRKLFIGGLDYRTTDSSLKEFYE 252 P TRK+F+GGL T+S K ++E Sbjct: 104 PGRTRKIFVGGLPSSVTESDFKTYFE 129 Score = 27.9 bits (59), Expect = 7.8 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 190 KLFIGGLDYRTTDSSLKEFY 249 KLFIGG+ + T + LKE++ Sbjct: 7 KLFIGGISWDTNEERLKEYF 26 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 64.9 bits (151), Expect = 6e-11 Identities = 31/86 (36%), Positives = 51/86 (59%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434 +GEI D V+M+D T + +GFGFIT++ +VD+ + H I+G+ VE KR +P+ Sbjct: 42 YGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIED-THVINGKQVEIKRTIPKGAGG 100 Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512 KK+FV G+ + E++L+ Sbjct: 101 NQSKDIKTKKIFVGGIPSTVTEDELK 126 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/47 (42%), Positives = 31/47 (65%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 L+++F+ +GN+V V+ D ET + RGFGFV FD + VD + + N Sbjct: 125 LKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGN 171 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/67 (34%), Positives = 40/67 (59%), Gaps = 2/67 (2%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE--AQNNRPHKIDGRIVEPKRAVPREE 428 +G +V+ V++D +T RS+GFGF+ + +VDE ++ N D + VE K+A P++ Sbjct: 132 YGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQ-VEIKKAEPKKS 190 Query: 429 IKRPEAS 449 + R S Sbjct: 191 LNRSPPS 197 Score = 41.9 bits (94), Expect = 4e-04 Identities = 18/48 (37%), Positives = 29/48 (60%) Frame = +2 Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 ++F +G I ++ D+ TG+ RGFGF+ F D VD+V ++ H I Sbjct: 37 KHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKV-IEDTHVI 83 Score = 31.1 bits (67), Expect = 0.84 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +1 Query: 145 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249 P +G + + T+K+F+GG+ T+ LK+F+ Sbjct: 95 PKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFF 129 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 64.9 bits (151), Expect = 6e-11 Identities = 31/86 (36%), Positives = 51/86 (59%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434 +GEI D V+M+D T + +GFGFIT++ +VD+ + H I+G+ VE KR +P+ Sbjct: 42 YGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIED-THVINGKQVEIKRTIPKGAGG 100 Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512 KK+FV G+ + E++L+ Sbjct: 101 NQSKDIKTKKIFVGGIPSTVTEDELK 126 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/47 (42%), Positives = 31/47 (65%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 L+++F+ +GN+V V+ D ET + RGFGFV FD + VD + + N Sbjct: 125 LKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGN 171 Score = 41.9 bits (94), Expect = 4e-04 Identities = 18/48 (37%), Positives = 29/48 (60%) Frame = +2 Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 ++F +G I ++ D+ TG+ RGFGF+ F D VD+V ++ H I Sbjct: 37 KHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKV-IEDTHVI 83 Score = 37.9 bits (84), Expect = 0.007 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDE 356 +G +V+ V++D +T RS+GFGF+ + +VDE Sbjct: 132 YGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDE 165 Score = 31.1 bits (67), Expect = 0.84 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +1 Query: 145 PSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFY 249 P +G + + T+K+F+GG+ T+ LK+F+ Sbjct: 95 PKGAGGNQSKDIKTKKIFVGGIPSTVTEDELKDFF 129 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 62.1 bits (144), Expect = 4e-10 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425 +G I DVVVM D T+R +GFGFIT+ VD + H+++G++VE KRAVP+E Sbjct: 133 FGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKE 189 Score = 60.1 bits (139), Expect = 2e-09 Identities = 37/101 (36%), Positives = 56/101 (55%), Gaps = 14/101 (13%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE-- 428 +G++V+ V+M+D T R++GFGFI ++ V E H IDGR VE K+AVPR++ Sbjct: 29 YGDVVEAVIMRDRATGRARGFGFIVFADP-CVSERVIMDKHIIDGRTVEAKKAVPRDDQQ 87 Query: 429 -IKRPEA-----------SATVKKLFVAGLKQDIEEEDLES 515 +KR + KK+FV GL I EE+ ++ Sbjct: 88 VLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKN 128 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/48 (41%), Positives = 33/48 (68%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 RLR+YFS +G++V ++ D+ TG+ RGFGF+ F D +RV + ++ Sbjct: 21 RLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVIMDKH 68 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/49 (44%), Positives = 29/49 (59%) Frame = +2 Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 + YF FG I V V+ D T + RGFGF+ FD D VDRV + H++ Sbjct: 127 KNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHEL 175 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 62.1 bits (144), Expect = 4e-10 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425 +G I DVVVM D T+R +GFGFIT+ VD + H+++G++VE KRAVP+E Sbjct: 133 FGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKE 189 Score = 60.1 bits (139), Expect = 2e-09 Identities = 37/101 (36%), Positives = 56/101 (55%), Gaps = 14/101 (13%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE-- 428 +G++V+ V+M+D T R++GFGFI ++ V E H IDGR VE K+AVPR++ Sbjct: 29 YGDVVEAVIMRDRATGRARGFGFIVFADP-CVSERVIMDKHIIDGRTVEAKKAVPRDDQQ 87 Query: 429 -IKRPEA-----------SATVKKLFVAGLKQDIEEEDLES 515 +KR + KK+FV GL I EE+ ++ Sbjct: 88 VLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKN 128 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/48 (41%), Positives = 33/48 (68%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 RLR+YFS +G++V ++ D+ TG+ RGFGF+ F D +RV + ++ Sbjct: 21 RLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVIMDKH 68 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/49 (44%), Positives = 29/49 (59%) Frame = +2 Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 + YF FG I V V+ D T + RGFGF+ FD D VDRV + H++ Sbjct: 127 KNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHEL 175 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 62.1 bits (144), Expect = 4e-10 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425 +G I DVVVM D T+R +GFGFIT+ VD + H+++G++VE KRAVP+E Sbjct: 133 FGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKE 189 Score = 60.1 bits (139), Expect = 2e-09 Identities = 37/101 (36%), Positives = 56/101 (55%), Gaps = 14/101 (13%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE-- 428 +G++V+ V+M+D T R++GFGFI ++ V E H IDGR VE K+AVPR++ Sbjct: 29 YGDVVEAVIMRDRATGRARGFGFIVFADP-CVSERVIMDKHIIDGRTVEAKKAVPRDDQQ 87 Query: 429 -IKRPEA-----------SATVKKLFVAGLKQDIEEEDLES 515 +KR + KK+FV GL I EE+ ++ Sbjct: 88 VLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKN 128 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/48 (41%), Positives = 33/48 (68%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 RLR+YFS +G++V ++ D+ TG+ RGFGF+ F D +RV + ++ Sbjct: 21 RLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVIMDKH 68 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/49 (44%), Positives = 29/49 (59%) Frame = +2 Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 + YF FG I V V+ D T + RGFGF+ FD D VDRV + H++ Sbjct: 127 KNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHEL 175 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 61.7 bits (143), Expect = 5e-10 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425 +G I DVVVM D T+R +GFGFIT+ VD + H+++G++VE KRAVP+E Sbjct: 145 FGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRAVPKE 201 Score = 57.6 bits (133), Expect = 8e-09 Identities = 36/104 (34%), Positives = 58/104 (55%), Gaps = 17/104 (16%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE-- 428 +G++V+ V+M+D T R++GFGFI ++ + + ++ H IDGR VE K+AVPR++ Sbjct: 38 YGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVIMDK-HIIDGRTVEAKKAVPRDDQQ 96 Query: 429 -IKR---------PE-----ASATVKKLFVAGLKQDIEEEDLES 515 +KR P A KK+FV GL I E + ++ Sbjct: 97 VLKRHASPMHLISPSHGGNGGGARTKKIFVGGLPSSITEAEFKN 140 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/48 (39%), Positives = 32/48 (66%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 RL+EYF +G++V ++ D+ TG+ RGFGF+ F D +RV + ++ Sbjct: 30 RLQEYFGKYGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVIMDKH 77 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/49 (40%), Positives = 28/49 (57%) Frame = +2 Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 + YF FG I V V+ D T + RGFGF+ FD + VD V + H++ Sbjct: 139 KNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHEL 187 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 60.9 bits (141), Expect = 9e-10 Identities = 31/97 (31%), Positives = 57/97 (58%), Gaps = 10/97 (10%) Frame = +3 Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE- 428 ++GE+++ V+MKD T R++GFGF+ ++ ++ + + H IDG+IVE K+AVPR++ Sbjct: 28 SFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLLK-HIIDGKIVEAKKAVPRDDH 86 Query: 429 ---------IKRPEASATVKKLFVAGLKQDIEEEDLE 512 ++ + KK+FV GL + E + + Sbjct: 87 VVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFK 123 Score = 59.3 bits (137), Expect = 3e-09 Identities = 27/63 (42%), Positives = 41/63 (65%) Frame = +3 Query: 237 KRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAV 416 K+ +G I DVVVM D +T+R +GFGFI+Y VD+ H+++G++VE K AV Sbjct: 123 KKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAV 182 Query: 417 PRE 425 P++ Sbjct: 183 PKD 185 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/45 (46%), Positives = 31/45 (68%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637 RLR+YF +FG ++ ++ D+ TG+ RGFGFV F D + +RV L Sbjct: 21 RLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVL 65 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/49 (38%), Positives = 31/49 (63%) Frame = +2 Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 ++YF+ FG I V V+ D T + RGFGF+ +D + VD+V + H++ Sbjct: 123 KKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHEL 171 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +1 Query: 190 KLFIGGLDYRTTDSSLKE-FYEHGEKL 267 KLFIGG+ + T++ L++ F+ GE L Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGEVL 33 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 60.9 bits (141), Expect = 9e-10 Identities = 31/97 (31%), Positives = 57/97 (58%), Gaps = 10/97 (10%) Frame = +3 Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE- 428 ++GE+++ V+MKD T R++GFGF+ ++ ++ + + H IDG+IVE K+AVPR++ Sbjct: 28 SFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLLK-HIIDGKIVEAKKAVPRDDH 86 Query: 429 ---------IKRPEASATVKKLFVAGLKQDIEEEDLE 512 ++ + KK+FV GL + E + + Sbjct: 87 VVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFK 123 Score = 59.3 bits (137), Expect = 3e-09 Identities = 27/63 (42%), Positives = 41/63 (65%) Frame = +3 Query: 237 KRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAV 416 K+ +G I DVVVM D +T+R +GFGFI+Y VD+ H+++G++VE K AV Sbjct: 123 KKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAV 182 Query: 417 PRE 425 P++ Sbjct: 183 PKD 185 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/45 (46%), Positives = 31/45 (68%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637 RLR+YF +FG ++ ++ D+ TG+ RGFGFV F D + +RV L Sbjct: 21 RLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVL 65 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/49 (38%), Positives = 31/49 (63%) Frame = +2 Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 ++YF+ FG I V V+ D T + RGFGF+ +D + VD+V + H++ Sbjct: 123 KKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHEL 171 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +1 Query: 190 KLFIGGLDYRTTDSSLKE-FYEHGEKL 267 KLFIGG+ + T++ L++ F+ GE L Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGEVL 33 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 60.1 bits (139), Expect = 2e-09 Identities = 28/50 (56%), Positives = 35/50 (70%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 LREYFS FG ++ V+V+ +K TG+ RGFGFV F D +DRV LQ H I Sbjct: 22 LREYFSNFGEVLQVTVMREKATGRPRGFGFVAFSDPAVIDRV-LQDKHHI 70 Score = 53.6 bits (123), Expect = 1e-07 Identities = 24/58 (41%), Positives = 38/58 (65%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE 428 +GE++ V VM++ T R +GFGF+ +S ++D ++ H ID R V+ KRA+ REE Sbjct: 29 FGEVLQVTVMREKATGRPRGFGFVAFSDPAVIDRVLQDK-HHIDNRDVDVKRAMSREE 85 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/57 (36%), Positives = 36/57 (63%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425 +G + D V+M D T+R +GFGF+++ VD + H ++G+ VE KRA+P++ Sbjct: 133 YGPVSDAVIMIDQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRALPKD 189 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/49 (40%), Positives = 28/49 (57%) Frame = +2 Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 R YF T+G + ++ D+ T + RGFGFV FD D VD V + H + Sbjct: 127 RAYFETYGPVSDAVIMIDQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDL 175 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 59.7 bits (138), Expect = 2e-09 Identities = 33/88 (37%), Positives = 54/88 (61%), Gaps = 1/88 (1%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR-EEI 431 +GE+VD V+M D T +GFGF+T++ + V E H ID R V+ KR +PR ++ Sbjct: 89 FGEVVDSVIMTDRITGNPRGFGFVTFADS-AVAEKVLEEDHVIDDRKVDLKRTLPRGDKD 147 Query: 432 KRPEASATVKKLFVAGLKQDIEEEDLES 515 +A + +K+FV GL +EE++L++ Sbjct: 148 TDIKAVSKTRKIFVGGLPPLLEEDELKN 175 Score = 47.6 bits (108), Expect = 9e-06 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631 L+ YF +G+I+ ++ D TG+ RGFGFV F D VDR+ Sbjct: 173 LKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRL 214 Score = 46.0 bits (104), Expect = 3e-05 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410 +K +G+I++ +M D T RS+GFGF+T+ VD + + H++ + VE KR Sbjct: 173 LKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKR 232 Query: 411 AVPR 422 A P+ Sbjct: 233 AEPK 236 Score = 45.6 bits (103), Expect = 4e-05 Identities = 21/47 (44%), Positives = 30/47 (63%) Frame = +2 Query: 515 YFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 YF FG +V ++TD+ TG RGFGFV F D ++V L+++H I Sbjct: 85 YFGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKV-LEEDHVI 130 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 59.3 bits (137), Expect = 3e-09 Identities = 27/63 (42%), Positives = 41/63 (65%) Frame = +3 Query: 237 KRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAV 416 K+ +G I DVVVM D +T+R +GFGFI+Y VD+ H+++G++VE K AV Sbjct: 50 KKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAV 109 Query: 417 PRE 425 P++ Sbjct: 110 PKD 112 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/49 (38%), Positives = 31/49 (63%) Frame = +2 Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 ++YF+ FG I V V+ D T + RGFGF+ +D + VD+V + H++ Sbjct: 50 KKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHEL 98 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 56.4 bits (130), Expect = 2e-08 Identities = 26/66 (39%), Positives = 38/66 (57%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434 +G DVVVM D T R +GFGF+TY V+ + H++ + VE KRA+P+E I+ Sbjct: 143 FGRTTDVVVMHDGVTNRPRGFGFVTYDSEDSVEVVMQSNFHELSDKRVEVKRAIPKEGIQ 202 Query: 435 RPEASA 452 +A Sbjct: 203 SNNGNA 208 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/40 (50%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF-DDYDPV 622 L++YFS +G ++ V +K TGK RGFGFV F +D D V Sbjct: 22 LKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVV 61 Score = 42.3 bits (95), Expect = 3e-04 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = +2 Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 + YF FG V V+ D T + RGFGFV +D D V+ V H++ Sbjct: 137 KSYFERFGRTTDVVVMHDGVTNRPRGFGFVTYDSEDSVEVVMQSNFHEL 185 Score = 35.9 bits (79), Expect = 0.030 Identities = 18/66 (27%), Positives = 39/66 (59%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413 +K+ +G +++ VV K+ T + +GFGF+ ++ V +A + H I G+ V+ ++A Sbjct: 22 LKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVVKALRD-THFILGKPVDVRKA 80 Query: 414 VPREEI 431 + + E+ Sbjct: 81 IRKHEL 86 Score = 30.3 bits (65), Expect = 1.5 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +1 Query: 184 TRKLFIGGLDYRTTDSSLKEFYE 252 T+K+F+GGL TT+ K ++E Sbjct: 119 TKKIFVGGLSSNTTEEEFKSYFE 141 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 53.2 bits (122), Expect = 2e-07 Identities = 25/51 (49%), Positives = 34/51 (66%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 +LRE+F+ +G + V+ DK TG+ RGFGFV F D +DRV LQ+ H I Sbjct: 21 KLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRV-LQEKHSI 70 Score = 52.4 bits (120), Expect = 3e-07 Identities = 21/57 (36%), Positives = 34/57 (59%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425 +G + DV +M D T R +GFGF+++ VD + H + G+ VE KRA+P++ Sbjct: 133 YGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRALPKD 189 Score = 52.0 bits (119), Expect = 4e-07 Identities = 24/58 (41%), Positives = 36/58 (62%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE 428 +GE+ +VM+D T R +GFGF+ +S ++D + H ID R V+ KRA+ REE Sbjct: 29 YGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQEK-HSIDTREVDVKRAMSREE 85 Score = 49.6 bits (113), Expect = 2e-06 Identities = 20/49 (40%), Positives = 30/49 (61%) Frame = +2 Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 R+YF +G + V+++ D+ T + RGFGFV FD D VD V + H + Sbjct: 127 RQYFEVYGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDL 175 Score = 33.5 bits (73), Expect = 0.16 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +1 Query: 133 LNMKPSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252 LN S GD Y + T+K+F+GGL TD ++++E Sbjct: 95 LNTSRSSGGDAYNK---TKKIFVGGLPPTLTDEEFRQYFE 131 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/50 (44%), Positives = 29/50 (58%) Frame = +2 Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 R +R YF FG IV V+TDK TG+ +G+GFV F + + R C N Sbjct: 35 RDTMRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEAAMRACQNMN 84 Score = 48.8 bits (111), Expect = 4e-06 Identities = 27/72 (37%), Positives = 37/72 (51%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413 ++R +GEIV+ VV+ D T RSKG+GF+T+ +A A N IDGR A Sbjct: 38 MRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEAAMRACQNMNPVIDGRRANCNLA 97 Query: 414 VPREEIKRPEAS 449 + RP S Sbjct: 98 CLGAQKPRPPTS 109 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 51.2 bits (117), Expect = 7e-07 Identities = 20/44 (45%), Positives = 29/44 (65%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637 LR YF FG+IV V+TDK +G+ +G+GFV F D + + C+ Sbjct: 23 LRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACV 66 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/57 (33%), Positives = 32/57 (56%) Frame = +3 Query: 222 HRFFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392 H+ ++ +G+IV+ VV+ D + RSKG+GF+T+ +A + IDGR Sbjct: 19 HKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGR 75 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 51.2 bits (117), Expect = 7e-07 Identities = 20/44 (45%), Positives = 29/44 (65%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637 LR YF FG+IV V+TDK +G+ +G+GFV F D + + C+ Sbjct: 23 LRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACV 66 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/57 (33%), Positives = 32/57 (56%) Frame = +3 Query: 222 HRFFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392 H+ ++ +G+IV+ VV+ D + RSKG+GF+T+ +A + IDGR Sbjct: 19 HKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGR 75 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 51.2 bits (117), Expect = 7e-07 Identities = 21/47 (44%), Positives = 27/47 (57%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 +R YF FG I+ ++TDK TGK +G+GFV F D D R N Sbjct: 33 MRRYFDQFGEILEAVIITDKATGKSKGYGFVTFRDSDSATRAVADPN 79 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/53 (33%), Positives = 31/53 (58%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392 ++R +GEI++ V++ D T +SKG+GF+T+ + A + IDGR Sbjct: 33 MRRYFDQFGEILEAVIITDKATGKSKGYGFVTFRDSDSATRAVADPNPVIDGR 85 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/47 (42%), Positives = 27/47 (57%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 +R YF FG I+ ++TDK TGK +G+GFV F + D R N Sbjct: 33 MRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPN 79 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/53 (33%), Positives = 32/53 (60%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392 ++R +GEI++ V++ D T +SKG+GF+T+ ++ A + IDGR Sbjct: 33 MRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGR 85 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/47 (42%), Positives = 27/47 (57%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 +R YF FG I+ ++TDK TGK +G+GFV F + D R N Sbjct: 33 MRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPN 79 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/53 (33%), Positives = 32/53 (60%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392 ++R +GEI++ V++ D T +SKG+GF+T+ ++ A + IDGR Sbjct: 33 MRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGR 85 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 49.6 bits (113), Expect = 2e-06 Identities = 19/35 (54%), Positives = 27/35 (77%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 LR+ F+ FG++V V+ D+ETG+ RGFGFV F+D Sbjct: 51 LRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFND 85 Score = 34.7 bits (76), Expect = 0.068 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKRAVPREEI 431 +G++VD V+ D +T RS+GFGF+ ++ A + K ++GR + A R Sbjct: 58 FGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPANDRPSA 117 Query: 432 KR 437 R Sbjct: 118 PR 119 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +1 Query: 190 KLFIGGLDYRTTDSSLKEFYEH 255 KLFIGGL + T D+SL++ + H Sbjct: 36 KLFIGGLSWGTDDASLRDAFAH 57 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 49.6 bits (113), Expect = 2e-06 Identities = 19/35 (54%), Positives = 27/35 (77%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 LR+ F+ FG++V V+ D+ETG+ RGFGFV F+D Sbjct: 51 LRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFND 85 Score = 34.7 bits (76), Expect = 0.068 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKRAVPREEI 431 +G++VD V+ D +T RS+GFGF+ ++ A + K ++GR + A R Sbjct: 58 FGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPANDRPSA 117 Query: 432 KR 437 R Sbjct: 118 PR 119 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +1 Query: 190 KLFIGGLDYRTTDSSLKEFYEH 255 KLFIGGL + T D+SL++ + H Sbjct: 36 KLFIGGLSWGTDDASLRDAFAH 57 >At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 100 Score = 49.2 bits (112), Expect = 3e-06 Identities = 25/53 (47%), Positives = 31/53 (58%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413 +GEIV V+ D T+RSKGFGF+T+ + A N H IDGR V K A Sbjct: 32 FGEIVYAKVVCDGATQRSKGFGFVTFREVESATRACENPNHTIDGRTVNCKLA 84 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/50 (44%), Positives = 26/50 (52%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 L YF FG IV VV D T + +GFGFV F + + R C NH I Sbjct: 25 LISYFERFGEIVYAKVVCDGATQRSKGFGFVTFREVESATRACENPNHTI 74 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/44 (43%), Positives = 29/44 (65%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637 LR +F +G+I+ V+TDK TG+ +G+GFV F D + R C+ Sbjct: 40 LRRHFDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEAARRACV 83 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/53 (35%), Positives = 30/53 (56%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392 ++R +G+I++ VV+ D T RSKG+GF+T+ A + IDGR Sbjct: 40 LRRHFDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEAARRACVDPTPIIDGR 92 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 48.8 bits (111), Expect = 4e-06 Identities = 21/51 (41%), Positives = 30/51 (58%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658 L +F FG I+ V+VV D+ET + +G+GFV F D + R C N I+ Sbjct: 29 LINFFKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACKDPNPTIE 79 Score = 43.2 bits (97), Expect = 2e-04 Identities = 22/60 (36%), Positives = 34/60 (56%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434 +GEI+ V V+ D +T RS+G+GF+T+ A A + I+GRI K A ++K Sbjct: 36 FGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACKDPNPTIEGRITNCKLAFVGAKVK 95 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 47.6 bits (108), Expect = 9e-06 Identities = 20/49 (40%), Positives = 29/49 (59%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 R LR+ F +G++V VV DK +G+ RGFGF+ FD+ +D N Sbjct: 21 RGLRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMN 69 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPRE 425 +G +V+ V+ D + RS+GFGFIT+ + +DEA +DGR + +A P + Sbjct: 30 YGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQPHQ 87 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +1 Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252 E+PE+ + FIGGL + T+D L++ +E Sbjct: 3 EDPEY--RCFIGGLAWTTSDRGLRDAFE 28 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 47.2 bits (107), Expect = 1e-05 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVC 634 LR++F +G I+ V+ DK TG+ +G+GFV F D + R C Sbjct: 40 LRQHFEQYGEILEAVVIADKNTGRSKGYGFVTFRDPEAARRAC 82 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392 +GEI++ VV+ D T RSKG+GF+T+ A + IDGR Sbjct: 47 YGEILEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPIIDGR 92 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/41 (48%), Positives = 26/41 (63%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625 RL + FS G +V VV D+ETG+ RGFGFV D D ++ Sbjct: 259 RLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELN 299 Score = 38.3 bits (85), Expect = 0.006 Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 5/89 (5%) Frame = +3 Query: 261 EIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPREEIKR 437 EI +V+ ++ T +S+GFGF+T S + A + + ++GR++ +A PR R Sbjct: 177 EIAEVIYNRE--TDQSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTVNKAAPRG--SR 232 Query: 438 PEASATVK----KLFVAGLKQDIEEEDLE 512 PE + V +++V L D++ LE Sbjct: 233 PERAPRVYEPAFRVYVGNLPWDVDNGRLE 261 Score = 35.5 bits (78), Expect = 0.039 Identities = 15/34 (44%), Positives = 24/34 (70%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359 G++V+ V+ D +T RS+GFGF+T S ++EA Sbjct: 268 GKVVEARVVYDRETGRSRGFGFVTMSDVDELNEA 301 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625 F G + V+ ++ET + RGFGFV D + Sbjct: 170 FEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAE 205 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 LRE F+ +G +V V+ D+ETG+ RGFGFV F Sbjct: 56 LREAFTKYGEVVDTRVILDRETGRSRGFGFVTF 88 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR 422 +GE+VD V+ D +T RS+GFGF+T++ + A Q + GR+V+ A R Sbjct: 63 YGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQALDGRDLHGRVVKVNYANDR 119 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +1 Query: 190 KLFIGGLDYRTTDSSLKE-FYEHGE 261 KLFIGG+ Y + SL+E F ++GE Sbjct: 41 KLFIGGMAYSMDEDSLREAFTKYGE 65 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 45.6 bits (103), Expect = 4e-05 Identities = 17/37 (45%), Positives = 26/37 (70%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616 L++ F++FG + +V+ D+ETG+ RGFGFV F D Sbjct: 51 LKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCED 87 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/53 (32%), Positives = 35/53 (66%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392 +K+ ++GE+ + V+ D +T RS+GFGF+++S +++ NN ++DG+ Sbjct: 51 LKQAFTSFGEVTEATVIADRETGRSRGFGFVSFS----CEDSANNAIKEMDGK 99 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +1 Query: 190 KLFIGGLDYRTTDSSLKE-FYEHGE 261 KLF+GGL + T DSSLK+ F GE Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFGE 60 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 45.6 bits (103), Expect = 4e-05 Identities = 17/37 (45%), Positives = 26/37 (70%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616 L++ F++FG + +V+ D+ETG+ RGFGFV F D Sbjct: 51 LKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCED 87 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/53 (32%), Positives = 35/53 (66%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392 +K+ ++GE+ + V+ D +T RS+GFGF+++S +++ NN ++DG+ Sbjct: 51 LKQAFTSFGEVTEATVIADRETGRSRGFGFVSFS----CEDSANNAIKEMDGK 99 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +1 Query: 190 KLFIGGLDYRTTDSSLKE-FYEHGE 261 KLF+GGL + T DSSLK+ F GE Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFGE 60 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/41 (46%), Positives = 27/41 (65%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625 RL FS G +V VV+D+ETG+ RGFGFV+ + + V+ Sbjct: 222 RLERLFSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVN 262 Score = 40.3 bits (90), Expect = 0.001 Identities = 25/87 (28%), Positives = 45/87 (51%), Gaps = 3/87 (3%) Frame = +3 Query: 261 EIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR--EEI 431 EI +V+ +D T +S+GFGF+T S ++A + +++GR + RA PR Sbjct: 140 EISEVIYNRD--TDQSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRLTVNRAAPRGSRPE 197 Query: 432 KRPEASATVKKLFVAGLKQDIEEEDLE 512 ++P +++V L D++ LE Sbjct: 198 RQPRVYDAAFRIYVGNLPWDVDSGRLE 224 Score = 35.5 bits (78), Expect = 0.039 Identities = 16/42 (38%), Positives = 27/42 (64%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359 ++R+ G++VD V+ D +T RS+GFGF+ S + V+ A Sbjct: 223 LERLFSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVA 264 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 45.2 bits (102), Expect = 5e-05 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPK 407 +G +VD +VM+D T RS+GFGF+TYS + A + K ++GR V K Sbjct: 26 YGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVSGMDGKELNGRRVSVK 77 Score = 41.9 bits (94), Expect = 4e-04 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625 LRE FS +GN+V V+ D+ T + RGFGFV + + + Sbjct: 19 LREAFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAE 58 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 44.8 bits (101), Expect = 6e-05 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 LRE FS +G +V ++ D+ETG+ RGF FV F Sbjct: 50 LREAFSKYGEVVDAKIIVDRETGRSRGFAFVTF 82 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/65 (27%), Positives = 31/65 (47%) Frame = +3 Query: 228 FFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPK 407 F ++ +GE+VD ++ D +T RS+GF F+T++ A + GR + Sbjct: 48 FGLREAFSKYGEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQLDGQDLHGRRIRVN 107 Query: 408 RAVPR 422 A R Sbjct: 108 YATER 112 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 44.8 bits (101), Expect = 6e-05 Identities = 21/56 (37%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIV 398 +K ++G+IVD VV+ D ++ S+GFGF+TY + + A +K +DGRI+ Sbjct: 52 LKEAFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQAMQNKELDGRII 107 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/37 (51%), Positives = 25/37 (67%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616 L+E F +FG IV VV D+E+G RGFGFV +D + Sbjct: 52 LKEAFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIE 88 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 44.4 bits (100), Expect = 8e-05 Identities = 16/35 (45%), Positives = 25/35 (71%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 L+ FS FG+++ ++ D+E+G+ RGFGFV F D Sbjct: 22 LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKD 56 Score = 34.3 bits (75), Expect = 0.090 Identities = 12/42 (28%), Positives = 27/42 (64%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359 ++R +G+++D ++ D ++ RS+GFGF+T+ + +A Sbjct: 22 LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDA 63 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 44.4 bits (100), Expect = 8e-05 Identities = 16/35 (45%), Positives = 25/35 (71%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 L+ FS FG+++ ++ D+E+G+ RGFGFV F D Sbjct: 22 LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKD 56 Score = 41.5 bits (93), Expect = 6e-04 Identities = 18/64 (28%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKR 410 ++R +G+++D ++ D ++ RS+GFGF+T+ + M D + ++DGR++ Sbjct: 22 LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNE 81 Query: 411 AVPR 422 A R Sbjct: 82 AQSR 85 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 44.4 bits (100), Expect = 8e-05 Identities = 16/35 (45%), Positives = 25/35 (71%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 L+ FS FG+++ ++ D+E+G+ RGFGFV F D Sbjct: 22 LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKD 56 Score = 41.5 bits (93), Expect = 6e-04 Identities = 18/64 (28%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKR 410 ++R +G+++D ++ D ++ RS+GFGF+T+ + M D + ++DGR++ Sbjct: 22 LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNE 81 Query: 411 AVPR 422 A R Sbjct: 82 AQSR 85 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 44.4 bits (100), Expect = 8e-05 Identities = 16/35 (45%), Positives = 25/35 (71%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 L+ FS FG+++ ++ D+E+G+ RGFGFV F D Sbjct: 22 LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKD 56 Score = 41.5 bits (93), Expect = 6e-04 Identities = 18/64 (28%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKR 410 ++R +G+++D ++ D ++ RS+GFGF+T+ + M D + ++DGR++ Sbjct: 22 LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNE 81 Query: 411 AVPR 422 A R Sbjct: 82 AQSR 85 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 44.4 bits (100), Expect = 8e-05 Identities = 15/48 (31%), Positives = 32/48 (66%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 +L++ F++FG +V V+TD+++G+ +GFGFV + + ++ + N Sbjct: 49 KLQDAFASFGQLVDARVITDRDSGRSKGFGFVTYATIEDAEKAKAEMN 96 Score = 43.6 bits (98), Expect = 1e-04 Identities = 24/64 (37%), Positives = 39/64 (60%), Gaps = 1/64 (1%) Frame = +3 Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKRAVPREE 428 ++G++VD V+ D + RSKGFGF+TY+ ++A+ K +DG ++ A PRE Sbjct: 56 SFGQLVDARVITDRDSGRSKGFGFVTYATIEDAEKAKAEMNAKFLDGWVIFVDPARPREP 115 Query: 429 IKRP 440 +RP Sbjct: 116 -RRP 118 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 44.4 bits (100), Expect = 8e-05 Identities = 16/37 (43%), Positives = 25/37 (67%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 R L F+ +G+++ ++ D+ETG+ RGFGFV F D Sbjct: 22 RALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKD 58 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422 +G+++D ++ D +T RS+GFGF+T+ + M D + +DGR + A R Sbjct: 31 YGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSR 87 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 44.4 bits (100), Expect = 8e-05 Identities = 16/37 (43%), Positives = 25/37 (67%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 R L F+ +G+++ ++ D+ETG+ RGFGFV F D Sbjct: 22 RALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKD 58 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422 +G+++D ++ D +T RS+GFGF+T+ + M D + +DGR + A R Sbjct: 31 YGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSR 87 >At2g21690.1 68415.m02580 RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 117 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/35 (45%), Positives = 25/35 (71%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 L + FS FGN++ ++ D++TGK R FGFV F++ Sbjct: 23 LTDIFSKFGNVIDSKIIYDRDTGKSRRFGFVTFEE 57 Score = 29.5 bits (63), Expect = 2.6 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359 +G ++D ++ D T +S+ FGF+T+ + + +A Sbjct: 30 FGNVIDSKIIYDRDTGKSRRFGFVTFEEEKSMTDA 64 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 43.6 bits (98), Expect = 1e-04 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ-IKRFNI 670 L++ FS+F + V+T+K TG+ RG+GFV F D + N Q + FNI Sbjct: 47 LKDAFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISAMNGQELNGFNI 102 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDY 613 LR YF FG +V +VV++ G+ +G+GF+ F DY Sbjct: 28 LRRYFEQFGQVVDANVVSETYPGRSKGYGFITFRDY 63 Score = 37.9 bits (84), Expect = 0.007 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGR 392 ++R +G++VD V+ + RSKG+GFIT+ V QN++P IDGR Sbjct: 28 LRRYFEQFGQVVDANVVSETYPGRSKGYGFITFRDYVSTVRALQNSKP-IIDGR 80 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/93 (24%), Positives = 49/93 (52%), Gaps = 1/93 (1%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413 ++ + ++G++ + +V+ D T +SKG+GF+T+ A KIDGR+ + A Sbjct: 91 LRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTFMHVDGALLALKEPSKKIDGRVTVTQLA 150 Query: 414 VPREEIKRPE-ASATVKKLFVAGLKQDIEEEDL 509 + + A +++K++VA + D+ + L Sbjct: 151 ASGNQGTGSQIADISMRKIYVANVPFDMPADRL 183 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/37 (45%), Positives = 24/37 (64%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616 LR FS++G++ V+ DK TGK +G+GFV F D Sbjct: 91 LRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTFMHVD 127 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGF 589 RL +F +G++ + DK TGK RGF Sbjct: 182 RLLNHFMAYGDVEEGPLGFDKVTGKSRGF 210 Score = 27.9 bits (59), Expect = 7.8 Identities = 17/63 (26%), Positives = 30/63 (47%) Frame = +3 Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431 A+G++ + + D T +S+GF Y A A + IDG+ + K AV ++ Sbjct: 189 AYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLAVDGKKG 248 Query: 432 KRP 440 +P Sbjct: 249 GKP 251 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/93 (24%), Positives = 49/93 (52%), Gaps = 1/93 (1%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413 ++ + ++G++ + +V+ D T +SKG+GF+T+ A KIDGR+ + A Sbjct: 91 LRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTFMHVDGALLALKEPSKKIDGRVTVTQLA 150 Query: 414 VPREEIKRPE-ASATVKKLFVAGLKQDIEEEDL 509 + + A +++K++VA + D+ + L Sbjct: 151 ASGNQGTGSQIADISMRKIYVANVPFDMPADRL 183 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/37 (45%), Positives = 24/37 (64%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616 LR FS++G++ V+ DK TGK +G+GFV F D Sbjct: 91 LRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTFMHVD 127 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGF 589 RL +F +G++ + DK TGK RGF Sbjct: 182 RLLNHFMAYGDVEEGPLGFDKVTGKSRGF 210 Score = 27.9 bits (59), Expect = 7.8 Identities = 17/63 (26%), Positives = 30/63 (47%) Frame = +3 Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431 A+G++ + + D T +S+GF Y A A + IDG+ + K AV ++ Sbjct: 189 AYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLAVDGKKG 248 Query: 432 KRP 440 +P Sbjct: 249 GKP 251 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/57 (36%), Positives = 34/57 (59%) Frame = +3 Query: 222 HRFFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392 H+ +K+ +GEI++ VV+ D + RSKG+GF+T+ +A A + IDGR Sbjct: 25 HKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGR 81 Score = 43.2 bits (97), Expect = 2e-04 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = +2 Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637 + ++++F FG I+ V+TDK +G+ +G+GFV F + + C+ Sbjct: 26 KETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACV 72 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/57 (36%), Positives = 34/57 (59%) Frame = +3 Query: 222 HRFFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392 H+ +K+ +GEI++ VV+ D + RSKG+GF+T+ +A A + IDGR Sbjct: 25 HKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGR 81 Score = 43.2 bits (97), Expect = 2e-04 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = +2 Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637 + ++++F FG I+ V+TDK +G+ +G+GFV F + + C+ Sbjct: 26 KETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACV 72 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/57 (36%), Positives = 34/57 (59%) Frame = +3 Query: 222 HRFFIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392 H+ +K+ +GEI++ VV+ D + RSKG+GF+T+ +A A + IDGR Sbjct: 25 HKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGR 81 Score = 43.2 bits (97), Expect = 2e-04 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = +2 Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637 + ++++F FG I+ V+TDK +G+ +G+GFV F + + C+ Sbjct: 26 KETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACV 72 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/42 (40%), Positives = 27/42 (64%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625 R L FS FG+I+ ++ +++TG+ RGFGF+ F D +D Sbjct: 21 RDLERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMD 62 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 1/64 (1%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410 ++R +G+I+D +M + T RS+GFGFIT++ +DE+ + R++ R Sbjct: 23 LERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNR 82 Query: 411 AVPR 422 A P+ Sbjct: 83 AEPK 86 >At1g71800.1 68414.m08298 cleavage stimulation factor, putative similar to cleavage stimulation factor 64 kilodalton subunit GB:AAD47839 GI:5713194 from [Drosophila melanogaster], SP|P33240 Cleavage stimulation factor, 64 kDa subunit {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 461 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/36 (50%), Positives = 25/36 (69%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 +LRE G +VS +VTD+ETGK +G+GF E+ D Sbjct: 24 QLREICGEVGPVVSFRLVTDRETGKPKGYGFCEYKD 59 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 42.3 bits (95), Expect = 3e-04 Identities = 16/33 (48%), Positives = 24/33 (72%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 L++ FS+FG + V + DK +G+ RGFGFV+F Sbjct: 57 LKDAFSSFGEVAEVRIAYDKGSGRSRGFGFVDF 89 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/29 (34%), Positives = 21/29 (72%) Frame = +3 Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQ 338 ++GE+ +V + D + RS+GFGF+ +++ Sbjct: 63 SFGEVAEVRIAYDKGSGRSRGFGFVDFAE 91 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 42.3 bits (95), Expect = 3e-04 Identities = 20/37 (54%), Positives = 25/37 (67%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616 L++ F FGNIVS V T E GK RG+GFV+F+ D Sbjct: 128 LQDMFKKFGNIVSCKVAT-LEDGKSRGYGFVQFEQED 163 Score = 35.1 bits (77), Expect = 0.052 Identities = 18/41 (43%), Positives = 25/41 (60%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628 LRE F+ FG IVS+++ D E RG+ FV FD+ + R Sbjct: 217 LREKFAEFGKIVSLAIAKD-ENRLCRGYAFVNFDNPEDARR 256 Score = 34.7 bits (76), Expect = 0.068 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 LR++FS G I S ++ D E GK +GFGFV F Sbjct: 320 LRKHFSQCGTITSTKLMCD-EKGKSKGFGFVCF 351 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 41.9 bits (94), Expect = 4e-04 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616 LR+ FS FG I ++ D ET + +GFGF+ FD D Sbjct: 23 LRQLFSPFGQIKEARLIRDSETQRPKGFGFITFDSED 59 Score = 41.1 bits (92), Expect = 8e-04 Identities = 21/68 (30%), Positives = 41/68 (60%), Gaps = 1/68 (1%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKI-DGRIVEPKR 410 ++++ +G+I + +++D +T+R KGFGFIT+ +A + KI DGR++ + Sbjct: 23 LRQLFSPFGQIKEARLIRDSETQRPKGFGFITFDSEDDARKALKSLDGKIVDGRLIFVEV 82 Query: 411 AVPREEIK 434 A EE++ Sbjct: 83 AKNAEEVR 90 >At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 41.5 bits (93), Expect = 6e-04 Identities = 17/46 (36%), Positives = 29/46 (63%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392 +G+I++ V++ D T+RSKG+GF+T+ A A + I+GR Sbjct: 40 YGDILEAVIISDKLTRRSKGYGFVTFKDAKAATRACEDSTPIINGR 85 Score = 39.1 bits (87), Expect = 0.003 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +2 Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVC 634 + + ++F +G+I+ +++DK T + +G+GFV F D R C Sbjct: 30 KEAMYDHFIKYGDILEAVIISDKLTRRSKGYGFVTFKDAKAATRAC 75 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 +L + F + GN+ V V+ DK TG+ RGFGFV V+ Q N Sbjct: 106 QLAQLFESAGNVEMVEVIYDKITGRSRGFGFVTMSSVSEVEAAAQQFN 153 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622 L FS G +V V+ D+++G+ +GFGFV +D V Sbjct: 220 LESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEV 258 Score = 37.1 bits (82), Expect = 0.013 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR 422 G++V+ V+ D + RSKGFGF+TY + V A ++ +DGR + A R Sbjct: 228 GKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEAEAR 283 Score = 35.1 bits (77), Expect = 0.052 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVD-EAQNNRPHKIDGR 392 G + V V+ D T RS+GFGF+T S V+ AQ +++DGR Sbjct: 115 GNVEMVEVIYDKITGRSRGFGFVTMSSVSEVEAAAQQFNGYELDGR 160 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 + +FS FG + V V +K+TGK + FGF++F+D Sbjct: 76 IEAFFSQFGTVKRVRVARNKKTGKSKHFGFIQFED 110 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/50 (34%), Positives = 30/50 (60%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 +R YF GN++ V+++ DK TG+++G FV++ DR ++QI Sbjct: 136 IRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRALHNQI 185 Score = 29.5 bits (63), Expect = 2.6 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 9/73 (12%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN--NRPHKIDG------ 389 ++ I +G + DV +M+D + ++S+G GF+ YS A + N + + G Sbjct: 227 VEEIFLQFGHVEDVYLMRD-EYRQSRGCGFVKYSSKETAMAAIDGLNGTYTMRGCNQPLI 285 Query: 390 -RIVEPKRAVPRE 425 R EPKR P E Sbjct: 286 VRFAEPKRPKPGE 298 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/50 (34%), Positives = 30/50 (60%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 +R YF GN++ V+++ DK TG+++G FV++ DR ++QI Sbjct: 136 IRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRALHNQI 185 Score = 29.5 bits (63), Expect = 2.6 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 9/73 (12%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN--NRPHKIDG------ 389 ++ I +G + DV +M+D + ++S+G GF+ YS A + N + + G Sbjct: 227 VEEIFLQFGHVEDVYLMRD-EYRQSRGCGFVKYSSKETAMAAIDGLNGTYTMRGCNQPLI 285 Query: 390 -RIVEPKRAVPRE 425 R EPKR P E Sbjct: 286 VRFAEPKRPKPGE 298 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 +L + F + GN+ V V+ DK TG+ RGFGFV V+ Q N Sbjct: 114 QLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFN 161 Score = 38.7 bits (86), Expect = 0.004 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPR 422 G++V+ V+ D + RSKGFGF+T S + V +A N+ +DGR + A R Sbjct: 273 GKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEAR 328 Score = 33.9 bits (74), Expect = 0.12 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVD-EAQNNRPHKIDGR 392 G + V V+ D T RS+GFGF+T S A V+ AQ ++ +GR Sbjct: 123 GNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFNGYEFEGR 168 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628 L F+ G +V V+ D+++G+ +GFGFV V + Sbjct: 265 LENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQK 305 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 +L + F + GN+ V V+ DK TG+ RGFGFV V+ Q N Sbjct: 114 QLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFN 161 Score = 38.7 bits (86), Expect = 0.004 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPR 422 G++V+ V+ D + RSKGFGF+T S + V +A N+ +DGR + A R Sbjct: 281 GKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEAR 336 Score = 33.9 bits (74), Expect = 0.12 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVD-EAQNNRPHKIDGR 392 G + V V+ D T RS+GFGF+T S A V+ AQ ++ +GR Sbjct: 123 GNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFNGYEFEGR 168 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628 L F+ G +V V+ D+++G+ +GFGFV V + Sbjct: 273 LENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQK 313 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 40.3 bits (90), Expect = 0.001 Identities = 15/31 (48%), Positives = 23/31 (74%) Frame = +2 Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 FS +G IV V+++ DK TGK +GF F+ ++D Sbjct: 56 FSQYGEIVDVNLIRDKGTGKSKGFAFLAYED 86 Score = 35.1 bits (77), Expect = 0.052 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN 368 +GEIVDV +++D T +SKGF F+ Y A +N Sbjct: 59 YGEIVDVNLIRDKGTGKSKGFAFLAYEDQRSTILAVDN 96 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 L+ F +G I SVV DK+TG+ +GFGFV F Sbjct: 179 LKAAFEVYGEITECSVVMDKDTGRAKGFGFVLF 211 Score = 33.9 bits (74), Expect = 0.12 Identities = 22/78 (28%), Positives = 33/78 (42%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413 +K +GEI + V+ D T R+KGFGF+ + A N ++ R V A Sbjct: 179 LKAAFEVYGEITECSVVMDKDTGRAKGFGFVLFKTRKGARAALKNPEKRMYNRTVSCLPA 238 Query: 414 VPREEIKRPEASATVKKL 467 P K E V+ + Sbjct: 239 RPFNSGKPREQQQPVESV 256 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/38 (42%), Positives = 26/38 (68%) Frame = +2 Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 + LRE+FS+ G I +VSV D++TG +G ++EF + Sbjct: 418 KNTLREHFSSCGEIKNVSVPIDRDTGNSKGIAYLEFSE 455 Score = 32.7 bits (71), Expect = 0.28 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 R + +F G +V V T+++ G RGFG VEF Sbjct: 310 RADVENFFKEAGEVVDVRFSTNRDDGSFRGFGHVEF 345 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/37 (45%), Positives = 24/37 (64%) Frame = +2 Query: 536 IVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 IVSV V+ +K G G+GFVEF+ +D D+V + N Sbjct: 129 IVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFN 165 Score = 33.9 bits (74), Expect = 0.12 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +2 Query: 506 LREYFST-FGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 L E FS + ++ + VV D TG+ +G+GFV F D + + + N Sbjct: 213 LHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAMTEMN 260 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/37 (45%), Positives = 24/37 (64%) Frame = +2 Query: 536 IVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 IVSV V+ +K G G+GFVEF+ +D D+V + N Sbjct: 129 IVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFN 165 Score = 33.9 bits (74), Expect = 0.12 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +2 Query: 506 LREYFST-FGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 L E FS + ++ + VV D TG+ +G+GFV F D + + + N Sbjct: 213 LHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAMTEMN 260 Score = 31.1 bits (67), Expect = 0.84 Identities = 25/93 (26%), Positives = 38/93 (40%), Gaps = 15/93 (16%) Frame = +3 Query: 279 VMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRAVPREE--------- 428 V+ D T RSKG+GF+ + + +A K R + A PR+ Sbjct: 229 VVLDANTGRSKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRIGPATPRKTNGYQQQGGY 288 Query: 429 -----IKRPEASATVKKLFVAGLKQDIEEEDLE 512 + RPE +FV GL + +EDL+ Sbjct: 289 MPNGTLTRPEGDIMNTTIFVGGLDSSVTDEDLK 321 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +1 Query: 193 LFIGGLDYRTTDSSLKE-FYEHGE 261 +F+GGLD TD LK+ F E GE Sbjct: 306 IFVGGLDSSVTDEDLKQPFNEFGE 329 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/52 (40%), Positives = 28/52 (53%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 + L E FS G IVS V TD G+ RG+GFV+FD D + N ++ Sbjct: 148 KTLHEAFSGCGTIVSCKVATD-HMGQSRGYGFVQFDTEDSAKNAIEKLNGKV 198 Score = 35.9 bits (79), Expect = 0.030 Identities = 19/48 (39%), Positives = 25/48 (52%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 +LRE F+ FG I S V+ D +G +G GFV F RV + N Sbjct: 343 KLRELFAEFGTITSCKVMRD-PSGTSKGSGFVAFSAASEASRVLNEMN 389 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649 +L +YF+ +VSV V D T G+G+V + + D ++ + N+ Sbjct: 61 QLYDYFTEVCQVVSVRVCRDAATNTSLGYGYVNYSNTDDAEKAMQKLNY 109 Score = 29.5 bits (63), Expect = 2.6 Identities = 20/78 (25%), Positives = 34/78 (43%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413 ++ + +G I VM+DP + SKG GF+ +S A N K+ G Sbjct: 344 LRELFAEFGTITSCKVMRDP-SGTSKGSGFVAFSAASEASRVLNEMNGKMVGGKPLYVAL 402 Query: 414 VPREEIKRPEASATVKKL 467 R+E +R + A ++ Sbjct: 403 AQRKEERRAKLQAQFSQM 420 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +2 Query: 536 IVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 IVS+ V+ +K G G+GFVEF+ +D D+V + N Sbjct: 131 IVSLKVIRNKHNGSSEGYGFVEFESHDVADKVLQEFN 167 Score = 33.9 bits (74), Expect = 0.12 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +2 Query: 506 LREYFST-FGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 L E FS + ++ + VV D TG+ +G+GFV F D + + + N Sbjct: 215 LHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAMTEMN 262 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +1 Query: 193 LFIGGLDYRTTDSSLKE-FYEHGE 261 +F+GGLD TD LK+ F E GE Sbjct: 308 IFVGGLDSSVTDEDLKQPFSEFGE 331 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 LR +FS FG IVS V+ D++TG+ R F F+ F Sbjct: 228 LRNHFSKFGTIVSTRVLHDRKTGRNRVFAFLSF 260 Score = 33.1 bits (72), Expect = 0.21 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598 +L + F FG ++SV V + +TG+ RG G+V Sbjct: 123 QLLDMFQPFGTVISVEVSRNPQTGESRGSGYV 154 Score = 31.5 bits (68), Expect = 0.64 Identities = 19/64 (29%), Positives = 34/64 (53%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434 +G IV V+ D KT R++ F F++++ D A + +G E +R + RE I+ Sbjct: 235 FGTIVSTRVLHDRKTGRNRVFAFLSFTSGEERDAALS-----FNGTQYEGRRIIVREGIE 289 Query: 435 RPEA 446 + E+ Sbjct: 290 KSES 293 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = +2 Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVE 601 ++ LR +FS G + V V TD+ETG RGF +++ Sbjct: 496 KKELRSHFSKCGEVTRVHVPTDRETGASRGFAYID 530 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 L FS G +VSV V+ +K TG+ G+GF+EF + +R N Sbjct: 40 LTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAERTLQTYN 86 Score = 35.1 bits (77), Expect = 0.052 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +2 Query: 506 LREYFST-FGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 L+E F + ++ VVTD TG+ +G+GFV+F + +R + N Sbjct: 132 LQETFRVHYSSVRGAKVVTDPSTGRSKGYGFVKFAEESERNRAMAEMN 179 Score = 29.5 bits (63), Expect = 2.6 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +3 Query: 279 VMKDPKTKRSKGFGFITYSQ 338 V+ DP T RSKG+GF+ +++ Sbjct: 148 VVTDPSTGRSKGYGFVKFAE 167 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652 L E FS G +V +V D+ + + +GFGFV F D + ++ N Q Sbjct: 50 LSEAFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALMEFNGQ 98 Score = 35.9 bits (79), Expect = 0.030 Identities = 16/35 (45%), Positives = 25/35 (71%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQ 362 G++V+ ++ D + RSKGFGF+T++ A DEAQ Sbjct: 58 GQVVEAQIVMDRVSDRSKGFGFVTFASA---DEAQ 89 >At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing protein low similarity to heterogeneous nuclear ribonucleoprotein G [Mus musculus] GI:5579009; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 152 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/59 (37%), Positives = 36/59 (61%), Gaps = 3/59 (5%) Frame = +3 Query: 231 FIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYS---QAHMVDEAQNNRPHKIDGRIV 398 F+KR A+GEI +V ++KD KRSKG+ FI ++ A + E + R + +GR++ Sbjct: 55 FLKREFSAFGEIAEVKLIKDEAMKRSKGYAFIQFTSQDDAFLAIETMDRRMY--NGRMI 111 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +2 Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 + L+ F ++G I SVV DK+TG+ +G+GFV F Sbjct: 421 QENLKTAFESYGEIEECSVVMDKDTGRGKGYGFVMF 456 Score = 32.7 bits (71), Expect = 0.28 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIV 398 +K ++GEI + V+ D T R KG+GF+ + EA ++ RIV Sbjct: 424 LKTAFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALKRPEKRMYNRIV 478 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +2 Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652 F+ FG + ++ D+ETG+ +GF FV F D D + + N Q Sbjct: 64 FNEFGEVFDSKIIIDRETGRSKGFRFVTFKDEDSMRTAIDRMNGQ 108 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGR 392 I+R +GE+ D ++ D +T RSKGF F+T+ + A ++DGR Sbjct: 60 IERCFNEFGEVFDSKIIIDRETGRSKGFRFVTFKDEDSMRTAIDRMNGQELDGR 113 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = +2 Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 FS+FG IV V+ D+ TG +G+GFV++ D Sbjct: 500 FSSFGEIVMAKVIKDRVTGLSKGYGFVKYAD 530 Score = 37.5 bits (83), Expect = 0.010 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGR 392 ++GEIV V+KD T SKG+GF+ Y+ M + A Q ++ +GR Sbjct: 502 SFGEIVMAKVIKDRVTGLSKGYGFVKYADVQMANTAVQAMNGYRFEGR 549 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = +2 Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 FS+FG IV V+ D+ TG +G+GFV++ D Sbjct: 500 FSSFGEIVMAKVIKDRVTGLSKGYGFVKYAD 530 Score = 37.5 bits (83), Expect = 0.010 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGR 392 ++GEIV V+KD T SKG+GF+ Y+ M + A Q ++ +GR Sbjct: 502 SFGEIVMAKVIKDRVTGLSKGYGFVKYADVQMANTAVQAMNGYRFEGR 549 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/47 (40%), Positives = 24/47 (51%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 L E F FG + V V D++TG RGFGFV F + R + N Sbjct: 229 LMELFHPFGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRAINKLN 275 Score = 29.9 bits (64), Expect = 1.9 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPR 422 +G + V V D KT S+GFGF+ + A N + D I+ + A PR Sbjct: 236 FGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRAINKLNGYGYDNLILRVEWATPR 292 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +2 Query: 506 LREYFSTFGNIVS-VSVVTDKETGKKRGFGFVEFDDYDPVD 625 L + FS FG I S ++ D +TG RGFGF+ +D ++ D Sbjct: 128 LYDTFSAFGVIASNPKIMRDPDTGNSRGFGFISYDSFEASD 168 Score = 32.7 bits (71), Expect = 0.28 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 279 VMKDPKTKRSKGFGFITYSQAHMVDEA 359 +M+DP T S+GFGFI+Y D A Sbjct: 144 IMRDPDTGNSRGFGFISYDSFEASDAA 170 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 38.7 bits (86), Expect = 0.004 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 R+L F +G I ++ ++TG+ RGFGF+ F D Sbjct: 26 RQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTD 62 Score = 34.7 bits (76), Expect = 0.068 Identities = 15/57 (26%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR 422 +G+I + +M T R +GFGFIT++ D+A ++ ++ +++ +A P+ Sbjct: 35 YGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPK 91 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 38.7 bits (86), Expect = 0.004 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 R+L F +G I ++ ++TG+ RGFGF+ F D Sbjct: 26 RQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTD 62 Score = 34.7 bits (76), Expect = 0.068 Identities = 15/57 (26%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPR 422 +G+I + +M T R +GFGFIT++ D+A ++ ++ +++ +A P+ Sbjct: 35 YGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPK 91 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 ++RE +FG + +V D+ETG +G+ F + D D C N Sbjct: 374 QVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALN 421 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359 ++ +L ++G + ++KD +T SKG+ F Y + D A Sbjct: 375 VRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIA 416 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 ++RE +FG + +V D+ETG +G+ F + D D C N Sbjct: 374 QVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALN 421 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359 ++ +L ++G + ++KD +T SKG+ F Y + D A Sbjct: 375 VRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIA 416 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 ++RE +FG + +V D+ETG +G+ F + D D C N Sbjct: 374 QVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALN 421 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359 ++ +L ++G + ++KD +T SKG+ F Y + D A Sbjct: 375 VRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIA 416 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = +2 Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631 F+ G +VS V+ +K+TG+ G+GF+EF + +RV Sbjct: 82 FAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAAAERV 119 Score = 34.3 bits (75), Expect = 0.090 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 L + +++ ++ VV D+ TG+ +G+GFV F D R + N Sbjct: 172 LETFRASYPSVKGAKVVIDRVTGRTKGYGFVRFSDESEQIRAMTEMN 218 Score = 27.9 bits (59), Expect = 7.8 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +1 Query: 172 EPEHTRKLFIGGLDYRTTDSSLKE-FYEHGE 261 +P +T +F+GGLD TD LK F ++GE Sbjct: 257 DPNNTT-VFVGGLDASVTDDHLKNVFSQYGE 286 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = +2 Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631 F+ G +VS V+ +K+TG+ G+GF+EF + +RV Sbjct: 82 FAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAAAERV 119 Score = 34.3 bits (75), Expect = 0.090 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 L + +++ ++ VV D+ TG+ +G+GFV F D R + N Sbjct: 172 LETFRASYPSVKGAKVVIDRVTGRTKGYGFVRFSDESEQIRAMTEMN 218 Score = 27.9 bits (59), Expect = 7.8 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +1 Query: 172 EPEHTRKLFIGGLDYRTTDSSLKE-FYEHGE 261 +P +T +F+GGLD TD LK F ++GE Sbjct: 257 DPNNTT-VFVGGLDASVTDDHLKNVFSQYGE 286 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 LR F+ FG + VVTD+ +G +GFGFV + Sbjct: 72 LRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRY 104 Score = 33.9 bits (74), Expect = 0.12 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKRAVPREE 428 +GE+ D V+ D + SKGFGF+ Y+ + K +DG ++ + A PRE+ Sbjct: 79 FGEVADAKVVTDRVSGYSKGFGFVRYATLEDSAKGIAGMDGKFLDGWVIFAEYARPREQ 137 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 +LR+ F FG + V + D ETG+ +GFGF++F Sbjct: 280 QLRQIFEAFGPVELVQLPLDPETGQCKGFGFIQF 313 Score = 32.7 bits (71), Expect = 0.28 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 R + E+FS G + V ++ D+ + + +G G++EF D Sbjct: 182 RDVYEFFSKAGKVRDVRLIMDRNSRRSKGVGYIEFYD 218 Score = 31.9 bits (69), Expect = 0.48 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQ--NNRPHKIDGRIVE 401 +++I A+G + V + DP+T + KGFGFI + Q AQ N +I GR ++ Sbjct: 281 LRQIFEAFGPVELVQLPLDPETGQCKGFGFIQFVQLEHSKAAQIALNGKLEIAGRTIK 338 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 37.9 bits (84), Expect = 0.007 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598 L E+FSTFG I V +V DKET + RG ++ Sbjct: 277 LMEHFSTFGKISEVHLVLDKETKRSRGIAYI 307 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +2 Query: 530 GNIVSVSVVTDKETGK--KRGFGFVEFDDYDPVDRV 631 G I+SV+++ K+ K G+GFVEFD + V Sbjct: 596 GKILSVTIIKHKKNEKYLSSGYGFVEFDSVETATSV 631 Score = 28.3 bits (60), Expect = 5.9 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 5/88 (5%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY----SQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422 +G+I +V ++ D +TKRS+G +I Y A ++E N+ GR++ A R Sbjct: 284 FGKISEVHLVLDKETKRSRGIAYILYLIPECAARAMEELDNS---SFQGRLLHILPAKHR 340 Query: 423 E-EIKRPEASATVKKLFVAGLKQDIEEE 503 E K+ ++ + K F KQ EE+ Sbjct: 341 ETSDKQVNDTSNLPKTF----KQKREEQ 364 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 37.5 bits (83), Expect = 0.010 Identities = 18/49 (36%), Positives = 31/49 (63%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVE 401 +G++VDV + +D +T S+GF F+ Y DEA + ++DGR+V+ Sbjct: 39 YGKVVDVFIPRDRRTGDSRGFAFVRYKYK---DEA-HKAVERLDGRVVD 83 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 37.5 bits (83), Expect = 0.010 Identities = 18/49 (36%), Positives = 31/49 (63%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVE 401 +G++VDV + +D +T S+GF F+ Y DEA + ++DGR+V+ Sbjct: 39 YGKVVDVFIPRDRRTGDSRGFAFVRYKYK---DEA-HKAVERLDGRVVD 83 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 37.5 bits (83), Expect = 0.010 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +2 Query: 521 STFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652 + +G++ VV D+ TG+ +G+GFV F D + R + N Q Sbjct: 176 NVYGSVKGAKVVLDRTTGRSKGYGFVRFADENEQMRAMTEMNGQ 219 Score = 35.5 bits (78), Expect = 0.039 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +2 Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 F+ G S V+ +K TG+ G+GF+EF + +RV N Sbjct: 80 FAQSGEATSAKVIRNKLTGQSEGYGFIEFVSHSVAERVLQTYN 122 Score = 30.7 bits (66), Expect = 1.1 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = +1 Query: 136 NMKPSESGDDYEEPEHTRKLFIGGLDYRTTDSSLKE-FYEHGEKL 267 N + + +GD+ +P +T +F+GGLD TD LK F + GE L Sbjct: 246 NTQGANAGDN--DPNNTT-IFVGGLDANVTDDELKSIFGQFGELL 287 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 37.5 bits (83), Expect = 0.010 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +2 Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 R L F +G I +VV DK TGK +GFGFV F Sbjct: 117 RETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMF 152 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392 +GEI + V+ D T ++KGFGF+ + EA +I R Sbjct: 127 YGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNR 172 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 37.5 bits (83), Expect = 0.010 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +2 Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 R L F +G I +VV DK TGK +GFGFV F Sbjct: 117 RETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMF 152 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392 +GEI + V+ D T ++KGFGF+ + EA +I R Sbjct: 127 YGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNR 172 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 37.5 bits (83), Expect = 0.010 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 +LRE+F+ FG I S V+ D +G RG GFV F + R + N Sbjct: 342 KLREHFAPFGTITSCKVMRD-PSGVSRGSGFVAFSTPEEATRAITEMN 388 Score = 36.3 bits (80), Expect = 0.022 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607 + L E FS FG I+S V D +G+ +G+GFV++D Sbjct: 147 KALHETFSAFGPILSCKVAVDP-SGQSKGYGFVQYD 181 Score = 35.1 bits (77), Expect = 0.052 Identities = 21/85 (24%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRAVPREEIK 434 G++V V V +D T+RS G+G++ Y+ A N ++GR + +V ++ Sbjct: 69 GQVVSVRVCRDMTTRRSLGYGYVNYATPQDASRALNELNFMALNGRAIRVMYSVRDPSLR 128 Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509 + + V +F+ L + I+ + L Sbjct: 129 K----SGVGNIFIKNLDKSIDHKAL 149 Score = 34.3 bits (75), Expect = 0.090 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628 L + F FG S ++ D E GK +GFGFV F++ D R Sbjct: 240 LNKVFGEFGVTTSCVIMRDGE-GKSKGFGFVNFENSDDAAR 279 Score = 31.5 bits (68), Expect = 0.64 Identities = 21/85 (24%), Positives = 41/85 (48%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413 + ++ +G V+M+D + K SKGFGF+ + + D+A ++G+ + K Sbjct: 240 LNKVFGEFGVTTSCVIMRDGEGK-SKGFGFVNFENS---DDAA-RAVDALNGKTFDDKEW 294 Query: 414 VPREEIKRPEASATVKKLFVAGLKQ 488 + K+ E +K+ F LK+ Sbjct: 295 FVGKAQKKSERETELKQKFEQSLKE 319 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 +L E F+ G +VSV V D T + G+G+V + Sbjct: 60 QLFEAFTQAGQVVSVRVCRDMTTRRSLGYGYVNY 93 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 37.1 bits (82), Expect = 0.013 Identities = 18/41 (43%), Positives = 24/41 (58%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628 L+ F +G I S V+ D E GK +GFGFV F++ D R Sbjct: 45 LKNAFGEYGKITSAVVMKDGE-GKSKGFGFVNFENADDAAR 84 Score = 35.5 bits (78), Expect = 0.039 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKR 410 +K +G+I VVMKD + K SKGFGF+ + A A ++ HK D + R Sbjct: 45 LKNAFGEYGKITSAVVMKDGEGK-SKGFGFVNFENADDAARAVESLNGHKFDDKEWYVGR 103 Query: 411 AVPREE 428 A + E Sbjct: 104 AQKKSE 109 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 37.1 bits (82), Expect = 0.013 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVE 401 G +VDV ++ D T RS+GFGF+T EA Q +I GR V+ Sbjct: 140 GTVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAMQMFNSSQIGGRTVK 188 Score = 35.1 bits (77), Expect = 0.052 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598 L + F G +V V +V DK T + RGFGFV Sbjct: 132 LSQIFGEAGTVVDVQIVYDKVTDRSRGFGFV 162 Score = 34.7 bits (76), Expect = 0.068 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 L++ F ++ V+ ++ TG+ RGFGF+ F+ + V N Sbjct: 235 LKDAFGDQPGVLGAKVIYERNTGRSRGFGFISFESAENVQSALATMN 281 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +3 Query: 264 IVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPREE 428 ++ V+ + T RS+GFGFI++ A V A +++GR + A RE+ Sbjct: 245 VLGAKVIYERNTGRSRGFGFISFESAENVQSALATMNGVEVEGRALRLNLASEREK 300 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 37.1 bits (82), Expect = 0.013 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +2 Query: 506 LREYFST-FGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 L E FS + ++ S VV D TG+ +G+GFV F D + R + N Sbjct: 218 LHETFSDRYPSVKSAKVVIDSNTGRSKGYGFVRFGDENERSRALTEMN 265 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 L FS G + SV V+ +K T + G+GFVEF Sbjct: 124 LHSCFSHTGEVSSVKVIRNKLTSQSEGYGFVEF 156 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN 368 GE+ V V+++ T +S+G+GF+ + +E N Sbjct: 132 GEVSSVKVIRNKLTSQSEGYGFVEFLSRAAAEEVLQN 168 Score = 28.3 bits (60), Expect = 5.9 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 LR+ FS FG +VSV + K G GFV+F D Sbjct: 337 LRQPFSQFGEVVSVKIPVGK------GCGFVQFAD 365 Score = 25.0 bits (52), Expect(2) = 5.2 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 8/58 (13%) Frame = +3 Query: 279 VMKDPKTKRSKGFGFITYSQAHMVDEAQ--------NNRPHKIDGRIVEPKRAVPREE 428 V+ D T RSKG+GF+ + + A +NR ++ I PKRA+ ++ Sbjct: 234 VVIDSNTGRSKGYGFVRFGDENERSRALTEMNGAYCSNRQMRVG--IATPKRAIANQQ 289 Score = 21.8 bits (44), Expect(2) = 5.2 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +3 Query: 441 EASATVKKLFVAGLKQDIEEEDL 509 + +T +FV G+ D+ +EDL Sbjct: 315 DGESTNATIFVGGIDPDVIDEDL 337 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 37.1 bits (82), Expect = 0.013 Identities = 18/36 (50%), Positives = 23/36 (63%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 RLRE F +G IVS V+ E G+ +GFGFV F + Sbjct: 319 RLREIFGCYGQIVSAKVMC-HENGRSKGFGFVCFSN 353 Score = 36.3 bits (80), Expect = 0.022 Identities = 17/34 (50%), Positives = 23/34 (67%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607 L F FG+I+S VV +E G+ +GFGFV+FD Sbjct: 128 LERMFCPFGSILSCKVV--EENGQSKGFGFVQFD 159 Score = 32.3 bits (70), Expect = 0.36 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 L FS +G + SV V+ D G+ RGFGFV F Sbjct: 218 LHTLFSQYGTVSSVVVMRDG-MGRSRGFGFVNF 249 Score = 32.3 bits (70), Expect = 0.36 Identities = 23/85 (27%), Positives = 41/85 (48%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413 ++ I +G+IV VM + RSKGFGF+ +S E ++G +V+ K Sbjct: 320 LREIFGCYGQIVSAKVMCH-ENGRSKGFGFVCFSNC----EESKQAKRYLNGFLVDGKPI 374 Query: 414 VPREEIKRPEASATVKKLFVAGLKQ 488 V R ++ + +++ F A +Q Sbjct: 375 VVRVAERKEDRIKRLQQYFQAQPRQ 399 Score = 28.7 bits (61), Expect = 4.5 Identities = 19/72 (26%), Positives = 35/72 (48%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434 +G + VVVM+D RS+GFGF+ + +A + + G + K+ + +K Sbjct: 225 YGTVSSVVVMRDGMG-RSRGFGFVNFCNPENAKKAMES----LCGLQLGSKKLFVGKALK 279 Query: 435 RPEASATVKKLF 470 + E +K+ F Sbjct: 280 KDERREMLKQKF 291 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 37.1 bits (82), Expect = 0.013 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 ++RE +FG + ++V D+ETG +G+ F + D D C N Sbjct: 390 QIRELLESFGPLRGFNLVKDRETGNSKGYAFCVYQDPSVTDIACAALN 437 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359 I+ +L ++G + ++KD +T SKG+ F Y + D A Sbjct: 391 IRELLESFGPLRGFNLVKDRETGNSKGYAFCVYQDPSVTDIA 432 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 37.1 bits (82), Expect = 0.013 Identities = 17/36 (47%), Positives = 25/36 (69%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607 + L E FS+FG I+S V D TG+ +G+GFV+F+ Sbjct: 150 KALFETFSSFGTILSCKVAMDV-TGRSKGYGFVQFE 184 Score = 36.7 bits (81), Expect = 0.017 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 +L+E FS +GN+ S V+ + + G RGFGFV + + + R + N Sbjct: 347 KLKEMFSEYGNVTSSKVMLNPQ-GMSRGFGFVAYSNPEEALRALSEMN 393 Score = 31.9 bits (69), Expect = 0.48 Identities = 25/93 (26%), Positives = 49/93 (52%), Gaps = 7/93 (7%) Frame = +3 Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA-----V 416 ++G I+ V D T RSKG+GF+ + + +E+ K++G ++ K+ + Sbjct: 158 SFGTILSCKVAMDV-TGRSKGYGFVQFEK----EESAQAAIDKLNGMLMNDKQVFVGHFI 212 Query: 417 PREEIKRPEASATVK--KLFVAGLKQDIEEEDL 509 R+E R E + T + ++V L ++I E++L Sbjct: 213 RRQERARDENTPTPRFTNVYVKNLPKEIGEDEL 245 Score = 29.9 bits (64), Expect = 1.9 Identities = 21/82 (25%), Positives = 35/82 (42%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413 +K + +G + VM +P+ S+GFGF+ YS A + K+ GR Sbjct: 348 LKEMFSEYGNVTSSKVMLNPQGM-SRGFGFVAYSNPEEALRALSEMNGKMIGRKPLYIAL 406 Query: 414 VPREEIKRPEASATVKKLFVAG 479 R+E +R A ++ G Sbjct: 407 AQRKEDRRAHLQALFSQIRAPG 428 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 36.7 bits (81), Expect = 0.017 Identities = 19/38 (50%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF-DDYD 616 LRE F FG + V + D +G+ RGF FVEF D YD Sbjct: 63 LREPFERFGPVRDVYIPRDYYSGQPRGFAFVEFVDAYD 100 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKRAVPREEI 431 +G + DV + +D + + +GF F+ + A+ EAQ + + GR E V E Sbjct: 70 FGPVRDVYIPRDYYSGQPRGFAFVEFVDAYDAGEAQRSMNRRSFAGR--EITVVVASESR 127 Query: 432 KRPE 443 KRPE Sbjct: 128 KRPE 131 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 36.7 bits (81), Expect = 0.017 Identities = 17/59 (28%), Positives = 30/59 (50%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM 676 + LR F FG +V V ++ DK + + +G+ F+E+ + + N +I N WM Sbjct: 296 KTLRAAFEGFGELVEVKIIMDKISKRSKGYAFLEYTTEEAAGTALKEMNGKI--INGWM 352 Score = 35.1 bits (77), Expect = 0.052 Identities = 16/48 (33%), Positives = 31/48 (64%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIV 398 +GE+V+V ++ D +KRSKG+ F+ Y+ +EA +++G+I+ Sbjct: 305 FGELVEVKIIMDKISKRSKGYAFLEYT----TEEAAGTALKEMNGKII 348 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +1 Query: 148 SESGDDYEEPE-HTRKLFIGGLDYRTTDSSLKEFYE 252 S DD E P T+KLFI GL + T++ +L+ +E Sbjct: 268 SRDQDDSESPPVKTKKLFITGLSFYTSEKTLRAAFE 303 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 36.3 bits (80), Expect = 0.022 Identities = 18/40 (45%), Positives = 23/40 (57%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625 LR+ F FG + + + D TG RGFGFV+F DP D Sbjct: 52 LRKSFEQFGPVKDIYLPRDYYTGDPRGFGFVQF--MDPAD 89 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 36.3 bits (80), Expect = 0.022 Identities = 22/58 (37%), Positives = 34/58 (58%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPK 407 +KR+ +GEI VVMKD + K S+ FGF+ + +A EA K++G +V+ K Sbjct: 135 LKRLFGEFGEITSAVVMKDGEGK-SRRFGFVNFEKA----EAAVTAIEKMNGVVVDEK 187 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 36.3 bits (80), Expect = 0.022 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKI-DGRIVEPKRA 413 G++ DV ++ DP T+ S+GFGFI+ + + H + GR++ ++A Sbjct: 99 GKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVEKA 151 Score = 34.7 bits (76), Expect = 0.068 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 R L ++F+ G + V +V D T + RGFGF+ +R +H + Sbjct: 89 RDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSV 140 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 35.5 bits (78), Expect = 0.039 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +2 Query: 506 LREYF-STFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652 L E F + + ++ VV D+ TG+ +G+GFV F D R + N Q Sbjct: 189 LTETFKAVYSSVKGAKVVNDRTTGRSKGYGFVRFADESEQIRAMTEMNGQ 238 Score = 31.5 bits (68), Expect = 0.64 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628 L F G + V+ +K+ G G+GF+EF ++ +R Sbjct: 96 LMNVFGLTGEATAAKVIRNKQNGYSEGYGFIEFVNHATAER 136 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 35.5 bits (78), Expect = 0.039 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 L + FS F + V+ D++TG+ RGFGFV F Sbjct: 160 LYQSFSVFSSCSDARVMWDQKTGRSRGFGFVSF 192 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 270 DVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN 365 D VM D KT RS+GFGF+++ A N Sbjct: 172 DARVMWDQKTGRSRGFGFVSFRNQQDAQTAIN 203 >At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a) almost identical to SC35-like splicing factor SCL30a GI:9843661 from [Arabidopsis thaliana]; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 35.5 bits (78), Expect = 0.039 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 LR F FG + + + D TG RGFGF++F DP D + HQ+ Sbjct: 53 LRRPFEQFGPVKDIYLPRDYYTGDPRGFGFIQF--MDPAD--AAEAKHQM 98 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 35.5 bits (78), Expect = 0.039 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 LRE S +G I ++ +V TG RG+GFVE++ + R +H + Sbjct: 80 LREVMSKYGRIKNLRLVRHIVTGASRGYGFVEYETEKEMLRAYEDAHHSL 129 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/54 (25%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGR 392 ++ ++ +G I ++ +++ T S+G+GF+ Y + A + H IDGR Sbjct: 80 LREVMSKYGRIKNLRLVRHIVTGASRGYGFVEYETEKEMLRAYEDAHHSLIDGR 133 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 35.5 bits (78), Expect = 0.039 Identities = 21/51 (41%), Positives = 30/51 (58%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658 LR+ F +FG++ V V D ETG +GFGFV+F + R L N Q++ Sbjct: 301 LRKVFESFGSVELVQVPRD-ETGLCKGFGFVQFARLEDA-RNALNLNGQLE 349 Score = 34.3 bits (75), Expect = 0.090 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 R + E+FS G + V ++ D+ + + RG G+VEF D Sbjct: 196 RDVYEFFSRAGKVRDVRIIMDRISRRSRGIGYVEFYD 232 Score = 31.1 bits (67), Expect = 0.84 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 1/75 (1%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN-NRPHKIDGRIVEPKR 410 ++++ ++G + V V +D +T KGFGF+ +++ A N N +I GR ++ Sbjct: 301 LRKVFESFGSVELVQVPRD-ETGLCKGFGFVQFARLEDARNALNLNGQLEIAGRAIKVSA 359 Query: 411 AVPREEIKRPEASAT 455 + E+ PEA T Sbjct: 360 VTDQTEV--PEAGQT 372 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 35.5 bits (78), Expect = 0.039 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607 LR+ F FGN++ +++V DK + +GF F+ ++ Sbjct: 93 LRDTFEQFGNLIHMNMVMDKVANRPKGFAFLRYE 126 Score = 28.3 bits (60), Expect = 5.9 Identities = 9/21 (42%), Positives = 17/21 (80%) Frame = +1 Query: 190 KLFIGGLDYRTTDSSLKEFYE 252 KL++ GL +RTT+ +L++ +E Sbjct: 78 KLYVSGLSFRTTEDTLRDTFE 98 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 35.5 bits (78), Expect = 0.039 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607 + L E FS+FG I+S V D G+ +G+GFV+F+ Sbjct: 146 KALYETFSSFGTILSCKVAMDV-VGRSKGYGFVQFE 180 Score = 28.7 bits (61), Expect = 4.5 Identities = 23/94 (24%), Positives = 48/94 (51%), Gaps = 7/94 (7%) Frame = +3 Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA-----V 416 ++G I+ V D RSKG+GF+ + + +E K++G ++ K+ V Sbjct: 154 SFGTILSCKVAMDV-VGRSKGYGFVQFEK----EETAQAAIDKLNGMLLNDKQVFVGHFV 208 Query: 417 PREEIKRPEASA--TVKKLFVAGLKQDIEEEDLE 512 R++ R E+ A + ++V L ++I +++L+ Sbjct: 209 RRQDRARSESGAVPSFTNVYVKNLPKEITDDELK 242 >At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, putative Length = 506 Score = 35.5 bits (78), Expect = 0.039 Identities = 14/50 (28%), Positives = 28/50 (56%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 L FS FG +VS V+ D +TG + F+EF++ + ++ + ++ + Sbjct: 259 LHTIFSRFGTVVSADVIRDFKTGDSLCYAFIEFENKESCEQAYFKMDNAL 308 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 35.1 bits (77), Expect = 0.052 Identities = 13/51 (25%), Positives = 28/51 (54%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 RL++ FS FG + +V ++ ++ T + G+G+V F+ + N ++ Sbjct: 73 RLKKVFSEFGQVTNVKIIANERTRQSLGYGYVWFNSKEDAQSAVEAMNGKV 123 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 35.1 bits (77), Expect = 0.052 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 L E F FG + V D++T RGFGFV F + R + N Sbjct: 190 LMELFRPFGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRAINKLN 236 Score = 27.9 bits (59), Expect = 7.8 Identities = 15/60 (25%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPREEI 431 +G + V D KT S+GFGF+++ A N + D I+ + + P+ ++ Sbjct: 197 FGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRAINKLNGYGYDNLILRVEWSTPKTQL 256 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 35.1 bits (77), Expect = 0.052 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607 + L F +FG ++S V DK TG + FGFV +D Sbjct: 363 QELAAAFQSFGIVLSAKVFVDKATGVSKCFGFVSYD 398 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 35.1 bits (77), Expect = 0.052 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359 +K++ GE+ +V ++K+P+TK+SKG F+ ++ A Sbjct: 230 LKKVFGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKRA 271 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 35.1 bits (77), Expect = 0.052 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 L + FS F + V+ D++TG+ RGFGFV F Sbjct: 164 LFDSFSAFNSCSDARVMWDQKTGRSRGFGFVSF 196 Score = 31.1 bits (67), Expect = 0.84 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN 365 A+ D VM D KT RS+GFGF+++ A N Sbjct: 170 AFNSCSDARVMWDQKTGRSRGFGFVSFRNQQDAQTAIN 207 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 35.1 bits (77), Expect = 0.052 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 L+E F FG ++ V + D+ RG G+VEF Sbjct: 114 LKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEF 146 Score = 31.1 bits (67), Expect = 0.84 Identities = 17/71 (23%), Positives = 36/71 (50%), Gaps = 2/71 (2%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGRIVEPKR 410 +K I +GE++ V + D +G G++ + ++AQ +IDG++V+ Sbjct: 114 LKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARADAEKAQLYMDGAQIDGKVVKATF 173 Query: 411 AV-PREEIKRP 440 + PR+++ P Sbjct: 174 TLPPRQKVSSP 184 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 35.1 bits (77), Expect = 0.052 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 L+E F FG ++ V + D+ RG G+VEF Sbjct: 114 LKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEF 146 Score = 31.1 bits (67), Expect = 0.84 Identities = 17/71 (23%), Positives = 36/71 (50%), Gaps = 2/71 (2%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGRIVEPKR 410 +K I +GE++ V + D +G G++ + ++AQ +IDG++V+ Sbjct: 114 LKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARADAEKAQLYMDGAQIDGKVVKATF 173 Query: 411 AV-PREEIKRP 440 + PR+++ P Sbjct: 174 TLPPRQKVSSP 184 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 34.7 bits (76), Expect = 0.068 Identities = 12/35 (34%), Positives = 24/35 (68%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607 RL++ FS FG + +V ++ ++ T + G+G+V F+ Sbjct: 92 RLKKVFSEFGQVTNVKIIANERTRQSLGYGYVWFN 126 >At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28) nearly identical to SC35-like splicing factor SCL28, 28 kD [Arabidopsis thaliana] GI:9843655; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 236 Score = 34.7 bits (76), Expect = 0.068 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 LR+ F FG + + + + TG+ RGFGFV++ + + NH++ Sbjct: 63 LRDSFERFGPLKDIYLPRNYYTGEPRGFGFVKYRYAEDAAEAMKRMNHKV 112 Score = 32.3 bits (70), Expect = 0.36 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDG 389 +G + D+ + ++ T +GFGF+ Y A EA HK+ G Sbjct: 70 FGPLKDIYLPRNYYTGEPRGFGFVKYRYAEDAAEAMKRMNHKVIG 114 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 34.7 bits (76), Expect = 0.068 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +2 Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 FS FG ++ SV+ G+ RGF F+EF+ D R L + ++ Sbjct: 37 FSDFGKVIR-SVLAKDFRGESRGFAFIEFESADSAGRAMLHMDGRL 81 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 34.7 bits (76), Expect = 0.068 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 L + + ++ VV D TG+ +G+GFV F D + R + N Sbjct: 230 LETFAGRYPSVKGAKVVIDSNTGRSKGYGFVRFGDENERSRAMTEMN 276 Score = 31.9 bits (69), Expect = 0.48 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 L FS + SV V+ +K+T + G+GFVEF Sbjct: 135 LHTCFSHTNEVSSVKVIRNKQTCQSEGYGFVEF 167 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 34.7 bits (76), Expect = 0.068 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 R L ++F+ G + V +V D T + RGFGF+ +R +H + Sbjct: 59 RDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSV 110 Score = 34.7 bits (76), Expect = 0.068 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKI-DGRIV 398 G++ DV ++ DP T+ S+GFGFI+ + + H + GR++ Sbjct: 69 GKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVI 116 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 34.7 bits (76), Expect = 0.068 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607 + L F FG ++S V DK TG + FGF+ +D Sbjct: 353 QELAATFQPFGKVLSAKVFVDKATGISKCFGFISYD 388 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 34.7 bits (76), Expect = 0.068 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607 + L F FG ++S V DK TG + FGF+ +D Sbjct: 344 QELAATFQPFGKVLSAKVFVDKATGISKCFGFISYD 379 >At5g65260.1 68418.m08209 polyadenylate-binding protein family protein / PABP family protein low similarity to poly(A)-binding protein II [Drosophila melanogaster] GI:6007612; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 220 Score = 34.3 bits (75), Expect = 0.090 Identities = 17/47 (36%), Positives = 30/47 (63%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 ++++F T G + V+++TDK G+ +GF +VEF + + V LQ N Sbjct: 108 VQQHFQTCGTVHRVTILTDK-FGQPKGFAYVEFVEVEAVQE-ALQLN 152 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 33.9 bits (74), Expect = 0.12 Identities = 24/62 (38%), Positives = 34/62 (54%) Frame = +3 Query: 279 VMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASATV 458 ++KD +T+R KGFGFIT+ D+AQ ++G+IV R + E K EA T Sbjct: 97 LIKDQQTQRPKGFGFITFESE---DDAQ-KALKALNGKIVN-GRLIFVETAKEVEAPTTS 151 Query: 459 KK 464 K Sbjct: 152 LK 153 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655 LR+ F+ F ++ D++T + +GFGF+ F+ D + N +I Sbjct: 87 LRQLFAPFARLIK-----DQQTQRPKGFGFITFESEDDAQKALKALNGKI 131 >At5g41690.1 68418.m05067 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GI:7673355 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 620 Score = 33.5 bits (73), Expect = 0.16 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = +2 Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 ++F+ G +VS+ ++ + E GK G+GFVEF D + +N Sbjct: 262 DFFNCVGEVVSIRLMVNHE-GKHVGYGFVEFASADETKKALENKN 305 >At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing protein low similarity to glycine-rich RNA-binding protein [Euphorbia esula] GI:2645699; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 337 Score = 33.5 bits (73), Expect = 0.16 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIV 398 ++R+ +G ++ V ++ D ++ R K +GF+T+S D+A + K I GR V Sbjct: 23 VRRVFSIYGSVLTVKIVND-RSVRGKCYGFVTFSNRRSADDAIEDMDGKSIGGRAV 77 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359 G++V V + P T +S GFGF+T+S V+ A Sbjct: 201 GKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAA 234 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 33.5 bits (73), Expect = 0.16 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 +++ F ++G I V +VTD+ T K +G+ F+E+ Sbjct: 153 KIKREFESYGPIKRVHLVTDQLTNKPKGYAFIEY 186 Score = 31.9 bits (69), Expect = 0.48 Identities = 25/73 (34%), Positives = 33/73 (45%), Gaps = 5/73 (6%) Frame = +3 Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGR----IV 398 IKR ++G I V ++ D T + KG+ FI Y + A KIDGR V Sbjct: 154 IKREFESYGPIKRVHLVTDQLTNKPKGYAFIEYMHTRDMKAAYKQADGQKIDGRRVLVDV 213 Query: 399 EPKRAVPREEIKR 437 E R VP +R Sbjct: 214 ERGRTVPNWRPRR 226 >At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing protein similar to ssRNA-binding protein [Dictyostelium discoideum] GI:1546894; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 L + F+ F V+ DK TGK +G+GFV F Sbjct: 153 LSKAFARFPTFNMAKVIRDKRTGKTKGYGFVSF 185 >At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 674 Score = 33.1 bits (72), Expect = 0.21 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 L +F+ FG ++ +VTD TG+ G ++EF Sbjct: 532 LSRHFNKFGEVLKAFIVTDPATGQPSGSAYIEF 564 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 32.7 bits (71), Expect = 0.28 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIV 398 G++V V+ D T RS+G+GF+ Y S+A M ++ +++GR + Sbjct: 201 GDVVGARVVFDGDTGRSRGYGFVCYSSKAEMETALESLDGFELEGRAI 248 Score = 32.3 bits (70), Expect = 0.36 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFV 598 F G++V VV D +TG+ RG+GFV Sbjct: 197 FRECGDVVGARVVFDGDTGRSRGYGFV 223 Score = 30.7 bits (66), Expect = 1.1 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 1/84 (1%) Frame = +3 Query: 261 EIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGRIVEPKRAVPREEIKR 437 E+V+V+ +D T +S+GF F+T S + +N + GR ++ A + K Sbjct: 112 ELVEVLYNRD--TGQSRGFAFVTMSNVEDCNIIIDNLDGTEYLGRALKVNFADKPKPNKE 169 Query: 438 PEASATVKKLFVAGLKQDIEEEDL 509 P T KLFV L + E L Sbjct: 170 PLYPETEHKLFVGNLSWTVTSESL 193 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616 L + F N V V+ +++TG+ RGF FV + + Sbjct: 101 LAQIIQDFANPELVEVLYNRDTGQSRGFAFVTMSNVE 137 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 32.3 bits (70), Expect = 0.36 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFV 598 FSTFG + V+V+ D+ T + RG FV Sbjct: 77 FSTFGKVARVTVLKDRHTRQSRGVAFV 103 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/70 (27%), Positives = 34/70 (48%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434 +G++ V V+KD T++S+G F+ Y D A+ R +D +I+ ++ Sbjct: 80 FGKVARVTVLKDRHTRQSRGVAFVLYVSRE--DAAKAAR--SMDAKILNGRKLTVSIAAD 135 Query: 435 RPEASATVKK 464 AS +KK Sbjct: 136 NGRASEFIKK 145 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 32.3 bits (70), Expect = 0.36 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 FS + V+ D++TG+ RGFGFV F Sbjct: 159 FSVYPTCSDARVMWDQKTGRSRGFGFVSF 187 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +3 Query: 270 DVVVMKDPKTKRSKGFGFITY 332 D VM D KT RS+GFGF+++ Sbjct: 167 DARVMWDQKTGRSRGFGFVSF 187 >At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 177 Score = 32.3 bits (70), Expect = 0.36 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 1/64 (1%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRP-HKIDGRIVEPKRAVPREEI 431 +G+I DV D ++ + FGF+T+ + A +N ++ GR++ A+P E+I Sbjct: 36 FGDIKDVKTPLDQANQKHRSFGFVTFLEREDASAAMDNMDGAELYGRVLTVNYALP-EKI 94 Query: 432 KRPE 443 K E Sbjct: 95 KGGE 98 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 L F FG+I V D+ K R FGFV F Sbjct: 29 LHAAFIPFGDIKDVKTPLDQANQKHRSFGFVTF 61 >At5g51120.1 68418.m06339 polyadenylate-binding protein, putative / PABP, putative contains similarity to poly(A)-binding protein II [Mus musculus] GI:2351846; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 227 Score = 31.9 bits (69), Expect = 0.48 Identities = 13/39 (33%), Positives = 27/39 (69%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622 ++++F + G + V+++TDK G+ +GF +VEF + + V Sbjct: 119 VQQHFQSCGTVNRVTILTDK-FGQPKGFAYVEFVEVEAV 156 >At1g45100.1 68414.m05170 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Nicotiana tabacum] GI:7673355, [Cucumis sativus] GI:7528270; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 497 Score = 31.9 bits (69), Expect = 0.48 Identities = 13/52 (25%), Positives = 27/52 (51%) Frame = +2 Query: 515 YFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670 +F G +V V ++ + + GK G+GFVEF + ++ ++ + + I Sbjct: 266 FFKDVGEVVHVRLIVNSQ-GKHAGWGFVEFASANEAEKALVKNGEYLHNYKI 316 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 ++ +F+ +VSV +V + E GK G+GFVEF Sbjct: 174 IKGFFNGVAQVVSVRLVVNHE-GKHVGYGFVEF 205 >At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing protein contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 173 Score = 31.5 bits (68), Expect = 0.64 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 530 GNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625 G ++ + + DKET K +GF F E++ + D Sbjct: 31 GRVIDLHIPRDKETDKPKGFAFAEYETEEIAD 62 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359 G ++D+ + +D +T + KGF F Y + D A Sbjct: 31 GRVIDLHIPRDKETDKPKGFAFAEYETEEIADYA 64 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 31.5 bits (68), Expect = 0.64 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607 + L F +FG ++S V DK TG + FG + FD Sbjct: 362 QELAAAFQSFGIVLSAKVFVDKATGVSKCFGKLSFD 397 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 31.5 bits (68), Expect = 0.64 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652 ++L E+FS FG I + DK TG+ +GF + + + L++ H+ Sbjct: 241 QKLLEFFSRFGEIEEGPLGLDKATGRPKGFALFVYRSLESAKK-ALEEPHK 290 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 31.1 bits (67), Expect = 0.84 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598 L E F +G I V DK +GK +G+GF+ Sbjct: 156 LIEAFKQYGEIEDCKAVFDKISGKSKGYGFI 186 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRI 395 +GEI D + D + +SKG+GFI Y A KI R+ Sbjct: 163 YGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRM 209 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652 ++L +FS FG I + DK TG+ +GF + + R L++ H+ Sbjct: 259 QKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKR-ALEEPHK 308 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 31.1 bits (67), Expect = 0.84 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598 L E F +G I V DK +GK +G+GF+ Sbjct: 156 LIEAFKQYGEIEDCKAVFDKISGKSKGYGFI 186 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRI 395 +GEI D + D + +SKG+GFI Y A KI R+ Sbjct: 163 YGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRM 209 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652 ++L +FS FG I + DK TG+ +GF + + R L++ H+ Sbjct: 259 QKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKR-ALEEPHK 308 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 31.1 bits (67), Expect = 0.84 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598 L E F +G I V DK +GK +G+GF+ Sbjct: 156 LIEAFKQYGEIEDCKAVFDKISGKSKGYGFI 186 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRI 395 +GEI D + D + +SKG+GFI Y A KI R+ Sbjct: 163 YGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRM 209 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652 ++L +FS FG I + DK TG+ +GF + + R L++ H+ Sbjct: 259 QKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKR-ALEEPHK 308 >At2g39090.1 68415.m04803 tetratricopeptide repeat (TPR)-containing protein low similarity to prediabetic NOD sera-reactive autoantigen [Mus musculus] GI:6670773, anaphase-promoting complex subunit 7 [Homo sapiens] GI:6180015; contains Pfam profile PF00515: TPR Domain Length = 558 Score = 31.1 bits (67), Expect = 0.84 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 253 AHRILLMKNLWFYSRVHR*KVYVCVQVLHSHRRFPKAS 140 A ++L+ + F+ R HR ++ Q LH + R PK S Sbjct: 43 AENLILLGDALFHQREHRRAIHTYKQALHHYTRIPKQS 80 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 31.1 bits (67), Expect = 0.84 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +3 Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIV 398 +G+++ V V+ D R KGF ++T+S ++A +DGR+V Sbjct: 44 YGQVLKVDVIMDKIRCRPKGFAYVTFSSKEEAEKALLELNAQLVDGRVV 92 >At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing protein low similarity to poly(A) binding protein II from [Xenopus laevis] GI:11527140, [Mus musculus] GI:2351846, [Bos taurus] GI:1051125; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 537 Score = 31.1 bits (67), Expect = 0.84 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359 G + +V+V+ DP T+ KG F+T++ V +A Sbjct: 469 GAVQNVIVVTDPVTRHPKGTAFVTFATKESVGKA 502 >At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing protein low similarity to enhancer binding protein-1; EBP1 [Entamoeba histolytica] GI:8163877, SP|P19682 28 kDa ribonucleoprotein, chloroplast precursor (28RNP) {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 500 RRLREYFST-FGNIVSVSVVTDKETGKKRGFGFVEF 604 + L+E+F GN+VS V+ + + G+GFV F Sbjct: 203 KHLKEFFDADTGNVVSTEVIFHENPRRSSGYGFVSF 238 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 231 FIKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQA 341 F+ IL G + + +DP TK+ KGFGF + A Sbjct: 218 FMMSILEFCGHVKSCLRAEDPTTKKPKGFGFYEFESA 254 >At5g10350.2 68418.m01201 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = +2 Query: 515 YFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 +F T G + V+++ DK G+ +GF +VEF + + V LQ N Sbjct: 108 HFQTCGTVNRVTILMDK-FGQPKGFAYVEFVEVEAVQE-ALQLN 149 >At5g10350.1 68418.m01200 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 217 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = +2 Query: 515 YFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646 +F T G + V+++ DK G+ +GF +VEF + + V LQ N Sbjct: 108 HFQTCGTVNRVTILMDK-FGQPKGFAYVEFVEVEAVQE-ALQLN 149 >At5g09830.1 68418.m01137 BolA-like family protein contains Pfam profile: PF01722 BolA-like protein Length = 93 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +1 Query: 301 RDQKDLDLLHILKPIWLMKLKIIGLTKLTEELSSQNEQFQGKRLKDQ 441 ++Q + L LKPI L + I G + E+ +EQF+GKRL ++ Sbjct: 4 KEQVEASLTSKLKPIHLEVIDISGGCGSSFEVEVVSEQFEGKRLLER 50 >At2g47310.1 68415.m05906 flowering time control protein-related / FCA gamma-related Length = 512 Score = 30.3 bits (65), Expect = 1.5 Identities = 9/33 (27%), Positives = 21/33 (63%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 +R+ F +GN+ + + DK TG++ + F+++ Sbjct: 126 IRQVFEKYGNVTEIILPKDKMTGERAAYCFIKY 158 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 270 DVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN 365 D VM D KT RS+GFGF+++ A N Sbjct: 180 DARVMWDQKTGRSRGFGFVSFRNQQDAQTAIN 211 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Frame = +2 Query: 506 LREYFSTFGNIVS----VSVVTDKETGKKRGFGFVEF 604 L + FS F + S V+ D++TG+ RGFGFV F Sbjct: 164 LFDSFSAFNSCSSYYRDARVMWDQKTGRSRGFGFVSF 200 >At5g13010.1 68418.m01491 RNA helicase, putative similar to DEAH-box RNA helicase [Chlamydomonas reinhardtii] GI:12044832; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 1226 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +3 Query: 363 NNRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEE 503 + +P +DGR+V K+A P +K P + + +GL ++I E+ Sbjct: 409 DTKPPFLDGRVVYTKQAEPVMPVKDPTSDMAIISRKGSGLVKEIREK 455 >At3g10845.1 68416.m01306 RNA recognition motif (RRM)-containing protein similar to SP|P42731 Polyadenylate-binding protein 2 (Poly(A) binding protein 2) (PABP 2) {Arabidopsis thaliana}; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 423 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/56 (26%), Positives = 31/56 (55%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667 +R+ +F F +V V ++ D ++GK G G+ EF + ++ Q+N + R++ Sbjct: 311 QRMLYFFQDF-EVVRVRLIVD-QSGKHMGCGYFEFASANEAEKALEQRNGKSLRYH 364 >At1g72800.1 68414.m08416 nuM1-related contains similarity with nuM1 GI:1279563 from [Medicago sativa] Length = 335 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 L +YFS+FG I V V TG G+ +++ + Sbjct: 254 LSKYFSSFGEITRVFVPPSHGTGGSLGYAYIDLKE 288 >At1g41855.1 68414.m04833 hypothetical protein Length = 261 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 291 PKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRAVP 419 P+ K KGFG + + + +E++N +PH + GR+ + P Sbjct: 13 PELKNVKGFGDLELLASKLEEESRNQKPHTRPPGRVHPAPHSTP 56 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359 GEI +V +MKD + SKG+ F+ + + +A Sbjct: 140 GEIFEVRLMKDRDSGDSKGYAFVAFKTKDVAQKA 173 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359 GE+ +V +M++ + KG+ F+T+ + EA Sbjct: 116 GEVTEVRIMREKDSGDGKGYAFVTFRSKDLAAEA 149 >At4g38440.1 68417.m05432 expressed protein Length = 1465 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +2 Query: 473 SWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKK 580 +WTE R LR FS GN+V VV+ ETG K Sbjct: 308 AWTERVEAARDLR--FSFDGNVVEEDVVSPAETGGK 341 >At4g30150.1 68417.m04287 expressed protein Length = 2009 Score = 28.3 bits (60), Expect = 5.9 Identities = 18/64 (28%), Positives = 29/64 (45%) Frame = -2 Query: 228 ICGSIVESTDKKFTCXXXXXXXXXXXXRLHI*YLLDLSPKMLIIN*ELDFSLIC*VFVSA 49 +CG +VE++D K L + +LL S +L +N ++D FVS Sbjct: 1477 VCGDVVETSDVKKKIIESLIKGDSSEVVLALKHLLIASAAILRLNLQIDGITFSPTFVSV 1536 Query: 48 VLNI 37 + NI Sbjct: 1537 LTNI 1540 >At1g56660.1 68414.m06516 expressed protein Length = 522 Score = 28.3 bits (60), Expect = 5.9 Identities = 24/105 (22%), Positives = 45/105 (42%), Gaps = 6/105 (5%) Frame = +3 Query: 285 KDPKTKRSKGFGFITYSQAHMVDE-AQNNRPHKIDGRIVEPKRAVPREEIKRPEASATVK 461 K+ K + K ++ + + +E + N+ + D E K+ P++E K+ E S + + Sbjct: 149 KNKKADKEKKHEDVSQEKEELEEEDGKKNKKKEKDESGTEEKKKKPKKEKKQKEESKSNE 208 Query: 462 KLFVAGLKQ-----DIEEEDLESXXXXXXXXXXXXXXQIKKQERK 581 V G K+ D+E+ED E KK ++K Sbjct: 209 DKKVKGKKEKGEKGDLEKEDEEKKKEHDETDQEMKEKDSKKNKKK 253 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 R + + FS +G +V + + K + G+ FVEFDD Sbjct: 21 REVEDLFSKYGPVVQIDL---KVPPRPPGYAFVEFDD 54 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 R + + FS +G +V + + K + G+ FVEFDD Sbjct: 21 REVEDLFSKYGPVVQIDL---KVPPRPPGYAFVEFDD 54 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610 R + + FS +G +V + + K + G+ FVEFDD Sbjct: 21 REVEDLFSKYGPVVQIDL---KVPPRPPGYAFVEFDD 54 >At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 141 Score = 27.9 bits (59), Expect = 7.8 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYS 335 G++ ++ +P+T+ S+GF F+T S Sbjct: 96 GKVASCFLVMEPRTRVSRGFAFVTMS 121 >At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 140 Score = 27.9 bits (59), Expect = 7.8 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = +3 Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYS 335 G++ ++ +P+T+ S+GF F+T S Sbjct: 95 GKVASCFLVMEPRTRVSRGFAFVTMS 120 >At1g79100.1 68414.m09223 arginine/serine-rich protein-related similar to arginine/serine-rich protein [Arabidopsis thaliana] GI:6601502 Length = 70 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604 ++R + FG I+ V + D+ RG +VEF Sbjct: 3 KIRVFRGDFGEIIHVQLAIDRAANLSRGDAYVEF 36 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,118,340 Number of Sequences: 28952 Number of extensions: 295392 Number of successful extensions: 1275 Number of sequences better than 10.0: 177 Number of HSP's better than 10.0 without gapping: 877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1256 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1712086600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -