BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30010 (545 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4H3.04c |||UPF0103 family|Schizosaccharomyces pombe|chr 1|||... 29 0.34 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 25 5.5 >SPAC4H3.04c |||UPF0103 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 309 Score = 29.5 bits (63), Expect = 0.34 Identities = 13/52 (25%), Positives = 27/52 (51%) Frame = -1 Query: 449 LYDELASYRRRTDPKRPDLHYSISNFNYSAIELLKVALRSFLRQIGRTAGNS 294 L D + Y+RR P P ++ SISN ++ +++++ + +T N+ Sbjct: 209 LEDAVLKYKRRGGPTSPKIYESISNLDHIGMKIIETKSSDDFSEYLKTTQNT 260 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 25.4 bits (53), Expect = 5.5 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 435 GQLPAPDRPETTRPSL 388 G P P RPE+TRP+L Sbjct: 758 GPPPQPARPESTRPAL 773 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,198,068 Number of Sequences: 5004 Number of extensions: 43630 Number of successful extensions: 82 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 225926624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -