BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30010 (545 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 2.8 CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. 24 2.8 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 24.2 bits (50), Expect = 2.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 456 RDPIRRTGQLPAPDRP 409 + P RR G P PDRP Sbjct: 74 KKPTRRAGVKPQPDRP 89 >CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. Length = 295 Score = 24.2 bits (50), Expect = 2.8 Identities = 12/47 (25%), Positives = 20/47 (42%) Frame = -2 Query: 535 PRLPALYRATHFPLYLSISRVSDGIVARSYTTNWPATGAGQTRNDPT 395 PRL + P + ++ DG+ R NW + +T +PT Sbjct: 238 PRLDWRIKILPLPRWNTVLACLDGLFIREKERNWEESKETETNINPT 284 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 548,566 Number of Sequences: 2352 Number of extensions: 11137 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50460840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -