BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30009 (801 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0435 + 5693035-5693669,5694999-5695241,5695806-5696007,569... 28 9.9 >04_01_0435 + 5693035-5693669,5694999-5695241,5695806-5696007, 5696188-5696583 Length = 491 Score = 27.9 bits (59), Expect = 9.9 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 3/51 (5%) Frame = +2 Query: 521 ITKIRLRLNHFDSDIALYSSITTLK-IVGFALIHP--VLRNVFEYKLVFQE 664 I + +L LN + SD+ LYS + +L ++ F HP V +N+ Y + QE Sbjct: 325 IAEFKLSLNAYLSDL-LYSPVRSLADVIAFNKAHPVEVRKNLVLYDALLQE 374 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,313,758 Number of Sequences: 37544 Number of extensions: 344470 Number of successful extensions: 556 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 556 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2174172540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -