BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30007 (796 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32767| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_32383| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_11932| Best HMM Match : RNA_pol_Rpb2_6 (HMM E-Value=0) 29 5.7 SB_10969| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_46036| Best HMM Match : PSRT (HMM E-Value=1) 28 7.6 >SB_32767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1259 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/51 (29%), Positives = 21/51 (41%) Frame = +3 Query: 291 PHATNYIAAAAPVHYASPVHYAAPVAKVIAPAHKVLVSAHHEEEYAHPKYD 443 PHA + A HYA P + AAP +++ K + P YD Sbjct: 622 PHAQVFFAGRGVHHYAIPQYTAAPSSEIAKIVKKEPTECNETSSVWRPWYD 672 >SB_32383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1850 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 684 KSNDEPRRTGAVGNMSC 634 KS+DEP+R G GNM C Sbjct: 277 KSSDEPKRYGMCGNMPC 293 >SB_11932| Best HMM Match : RNA_pol_Rpb2_6 (HMM E-Value=0) Length = 498 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 450 YSVADGHSGDNKSQHESRDGTLCTASTLWLKLTV-QCARLSTPL 578 YS+A G+ GD K H++R G + L T+ RL++P+ Sbjct: 38 YSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPI 81 >SB_10969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 846 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 450 YSVADGHSGDNKSQHESRDGTLCTASTLWLKLTV-QCARLSTPL 578 YS+A G+ GD K H++R G + L T+ RL++P+ Sbjct: 450 YSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPI 493 >SB_46036| Best HMM Match : PSRT (HMM E-Value=1) Length = 878 Score = 28.3 bits (60), Expect = 7.6 Identities = 18/68 (26%), Positives = 31/68 (45%) Frame = +3 Query: 387 HKVLVSAHHEEEYAHPKYDFAYSVADGHSGDNKSQHESRDGTLCTASTLWLKLTVQCARL 566 H+ + HH ++ HP+ D AD H D + + D T+ T+ K +V A+ Sbjct: 671 HRRQDADHHRQDVVHPRQD-----ADHHRQDAEHHRQDADHIAKTSFTIG-KTSVTIAKT 724 Query: 567 STPLTTTT 590 S + T+ Sbjct: 725 SVTIAKTS 732 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,280,346 Number of Sequences: 59808 Number of extensions: 241162 Number of successful extensions: 819 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 753 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 816 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2191792647 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -