BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30007 (796 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK126824-1|BAC86709.1| 524|Homo sapiens protein ( Homo sapiens ... 31 6.3 >AK126824-1|BAC86709.1| 524|Homo sapiens protein ( Homo sapiens cDNA FLJ44876 fis, clone BRAMY2031516. ). Length = 524 Score = 30.7 bits (66), Expect = 6.3 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +3 Query: 447 AYSVADGHSGDNKSQHESRDGTLCTASTLWL-KLTVQCARL 566 AYS + H ++ QHE D T+CT + LWL K CA L Sbjct: 476 AYSDSK-HGTNSDFQHELTDITVCTKAKLWLAKSFTTCASL 515 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,414,804 Number of Sequences: 237096 Number of extensions: 1136610 Number of successful extensions: 2858 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2858 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9757565650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -