BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30007 (796 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 25 1.1 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 7.5 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 7.5 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 24.6 bits (51), Expect = 1.1 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -1 Query: 583 VVSGVLNLAH*TVSFNQSVLAVHSVPSRDSCW 488 ++ G+L LA + N +L HS+ SR W Sbjct: 244 LMDGILGLALGPIRNNDRILYFHSLASRVESW 275 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 7.5 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 492 HESRDGTLCTASTLWLKLTVQC 557 HE++ TLC A +L +T+ C Sbjct: 733 HETQITTLCVAISLSATVTLVC 754 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 7.5 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 492 HESRDGTLCTASTLWLKLTVQC 557 HE++ TLC A +L +T+ C Sbjct: 823 HETQITTLCVAISLSATVTLVC 844 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,572 Number of Sequences: 438 Number of extensions: 2135 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25125039 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -