BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30005 (981 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_1023 + 13265179-13265330,13265526-13265637,13265752-132660... 29 4.3 01_06_1155 - 34957402-34957824 29 5.7 >03_02_1023 + 13265179-13265330,13265526-13265637,13265752-13266048, 13266361-13266623,13267637-13267847,13268420-13268590, 13268671-13268748,13269275-13269520,13269763-13271868, 13272122-13273904,13274113-13274216,13274752-13275108, 13275210-13275328,13276175-13276436,13276669-13276893, 13277075-13277214,13278087-13278159,13278431-13278532, 13278647-13279018,13279183-13279230,13279516-13279900, 13280440-13280558 Length = 2574 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 239 RFPGYGPRNFTNGSSLPIEQVLCER**IFDAEL 141 RFP +G F +LP+++V+ E+ FDA L Sbjct: 1500 RFPRFGVPRFIRSGNLPLDRVMTEQFIRFDASL 1532 >01_06_1155 - 34957402-34957824 Length = 140 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -2 Query: 128 RICLPSASRPATTGLSPLAKSMPNSLSCVREV 33 R+CLPS +RP L+ +A PN +R++ Sbjct: 17 RVCLPSPTRPPPRPLNHVAGKPPNRCRFLRQI 48 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,153,487 Number of Sequences: 37544 Number of extensions: 524442 Number of successful extensions: 1308 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1274 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1308 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2858396560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -