BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30004 (843 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF351129-1|AAL83921.1| 549|Drosophila melanogaster FMRFa recept... 29 8.0 AE014296-529|AAF47700.1| 549|Drosophila melanogaster CG2114-PA ... 29 8.0 >AF351129-1|AAL83921.1| 549|Drosophila melanogaster FMRFa receptor protein. Length = 549 Score = 29.1 bits (62), Expect = 8.0 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 Query: 231 VFNYYFCFIKLVLYSCFVSLHVGRHSRQGRRYARGNVRE 347 + NY F+ L + +C + V R +R+ +R +R RE Sbjct: 298 IVNYIIPFLTLAILNCLIYRQVKRANRERQRLSRSEKRE 336 >AE014296-529|AAF47700.1| 549|Drosophila melanogaster CG2114-PA protein. Length = 549 Score = 29.1 bits (62), Expect = 8.0 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 Query: 231 VFNYYFCFIKLVLYSCFVSLHVGRHSRQGRRYARGNVRE 347 + NY F+ L + +C + V R +R+ +R +R RE Sbjct: 298 IVNYIIPFLTLAILNCLIYRQVKRANRERQRLSRSEKRE 336 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,258,440 Number of Sequences: 53049 Number of extensions: 537615 Number of successful extensions: 1123 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1094 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1123 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4024321392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -