BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30002 (748 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0344 + 20442041-20442374,20443115-20443210,20444512-204446... 29 3.9 09_02_0594 + 11023016-11023053,11023103-11023349,11024590-11024712 28 9.1 >05_04_0344 + 20442041-20442374,20443115-20443210,20444512-20444633, 20444781-20445029,20445300-20445549,20446036-20446262 Length = 425 Score = 29.1 bits (62), Expect = 3.9 Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = -2 Query: 471 FYSVGSISFSNNVMIVDSNLKSEYSNDTAITLL--NFLKIVVKLY 343 + +GS + NN ++ + N ++EY+ D TLL + K + +LY Sbjct: 226 YVGMGSNDYLNNYLMPNYNTRNEYNGDQYSTLLVQQYTKQLTRLY 270 >09_02_0594 + 11023016-11023053,11023103-11023349,11024590-11024712 Length = 135 Score = 27.9 bits (59), Expect = 9.1 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 233 WCILPFKLSTDWQTKAQV 286 W +LPF++ TDW T Q+ Sbjct: 39 WTMLPFEVETDWLTLTQM 56 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,393,043 Number of Sequences: 37544 Number of extensions: 298463 Number of successful extensions: 468 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -