BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20999 (738 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 97 1e-22 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 97 1e-22 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 88 8e-20 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 27 0.16 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.6 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 3.4 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 22 4.5 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 97.5 bits (232), Expect = 1e-22 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = +3 Query: 579 INEPIAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGD 737 INEP AAAIAYGLDKK ERNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGD Sbjct: 1 INEPTAAAIAYGLDKKAEKERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGD 53 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 97.5 bits (232), Expect = 1e-22 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = +3 Query: 579 INEPIAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGD 737 INEP AAAIAYGLDKK ERNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGD Sbjct: 1 INEPTAAAIAYGLDKKAERERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGD 53 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 87.8 bits (208), Expect = 8e-20 Identities = 40/53 (75%), Positives = 49/53 (92%) Frame = +3 Query: 579 INEPIAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGD 737 INEP AAAIAYGLDKKG E+N+L++DLGGGTFDVSILTI++G+FEV +T+GD Sbjct: 1 INEPTAAAIAYGLDKKGA-EQNILVYDLGGGTFDVSILTIDNGVFEVVATSGD 52 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 27.1 bits (57), Expect = 0.16 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Frame = +1 Query: 172 DHSVLCCVHRHRASHRRCRQEPGGDEPHNTIFDAKRLI--GRKXEDATVQADMKHWPFEV 345 DH + +H + SH +QEP G N F RL+ D + ADM + + Sbjct: 342 DHQAM--LHHNPMSHH-LKQEPSGFTSSNHPFSINRLLPTAESKADIKMYADMHQYGYNT 398 Query: 346 VS 351 +S Sbjct: 399 LS 400 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.0 bits (47), Expect = 2.6 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +1 Query: 352 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT 477 D KPKI+ + ED+ E+ K K T + L KT Sbjct: 241 DKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDEELNKT 282 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 124 LPAREGGDHRQRPGQQDH 177 +P R+ DHR RP + H Sbjct: 246 IPIRQCDDHRDRPPRHFH 263 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 534 TKDAGTISGLNVLRIINEP 590 TKDAG +S + ++N+P Sbjct: 330 TKDAGLLSYPEICTLLNDP 348 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,354 Number of Sequences: 336 Number of extensions: 4207 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -