BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20998 (736 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 23 3.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 3.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 3.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 3.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 3.4 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 5.9 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 21 7.8 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -1 Query: 529 TTMNTAEGNTQQSFQLSSTLDIFQQY 452 TT N+ EG+ Q++ +++ D +Q Y Sbjct: 162 TTGNSGEGSLQENRYYNNSPDQYQSY 187 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 507 PSAVFIVVDNKKMVQHLDSPAIKVHKYSDG 596 PSAV +++D K ++L + ++H G Sbjct: 742 PSAVLLLIDLMKKNRNLGAACGRIHPVGSG 771 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 507 PSAVFIVVDNKKMVQHLDSPAIKVHKYSDG 596 PSAV +++D K ++L + ++H G Sbjct: 742 PSAVLLLIDLMKKNRNLGAACGRIHPVGSG 771 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 507 PSAVFIVVDNKKMVQHLDSPAIKVHKYSDG 596 PSAV +++D K ++L + ++H G Sbjct: 742 PSAVLLLIDLMKKNRNLGAACGRIHPVGSG 771 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 507 PSAVFIVVDNKKMVQHLDSPAIKVHKYSDG 596 PSAV +++D K ++L + ++H G Sbjct: 742 PSAVLLLIDLMKKNRNLGAACGRIHPVGSG 771 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -2 Query: 687 HALHLFEEDARQSRGRMVIGKQLKIPLVSICHLNIY 580 H+++L EED ++ + GK P HL + Sbjct: 237 HSINLLEEDNQKPNVCRICGKSYARPSTLKTHLRTH 272 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -3 Query: 320 IASTISKLWFLP 285 +A+T +K WFLP Sbjct: 102 VATTKTKAWFLP 113 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,001 Number of Sequences: 336 Number of extensions: 3645 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -