BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20996 (634 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22686| Best HMM Match : zf-C3HC4 (HMM E-Value=0.1) 29 3.1 SB_47744| Best HMM Match : RrnaAD (HMM E-Value=5.2e-06) 28 5.5 >SB_22686| Best HMM Match : zf-C3HC4 (HMM E-Value=0.1) Length = 265 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = -1 Query: 481 KCSRSLPAIIKRICEQLIFVTRQQKKXKFIKNL 383 +CS +++KR+C FV+RQ + +F+ +L Sbjct: 212 QCSLRWLSVVKRVCRICRFVSRQNCQWRFVSHL 244 >SB_47744| Best HMM Match : RrnaAD (HMM E-Value=5.2e-06) Length = 401 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 350 RWLKTSNDKFAKFSRLKKH*TP 285 RW K SN+ A FS L+KH P Sbjct: 10 RWRKISNNSLAVFSPLRKHCRP 31 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,526,130 Number of Sequences: 59808 Number of extensions: 296719 Number of successful extensions: 763 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 762 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -