BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20996 (634 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ138926-1|ABA86532.1| 1873|Drosophila melanogaster CG1241 protein. 33 0.42 BT015248-1|AAT94477.1| 1906|Drosophila melanogaster LP21012p pro... 33 0.42 AE014296-511|AAF47687.1| 1906|Drosophila melanogaster CG1241-PA ... 33 0.42 AE014297-110|AAF52119.1| 975|Drosophila melanogaster CG9783-PA ... 28 9.1 >DQ138926-1|ABA86532.1| 1873|Drosophila melanogaster CG1241 protein. Length = 1873 Score = 32.7 bits (71), Expect = 0.42 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = +2 Query: 5 LWPDYDFSVDLEEELTRMNINTTAPSPVENKLKLGLDKIIEDIQNILKRKTAYLKGLILN 184 +W S+ + EE + ++ P N +GL+K E I N+L R A L LN Sbjct: 100 MWSSVSSSMQMAEECMKQ-VDDDVPFLNHNNALIGLEKFAETIDNVLNRIRAKLTNTTLN 158 >BT015248-1|AAT94477.1| 1906|Drosophila melanogaster LP21012p protein. Length = 1906 Score = 32.7 bits (71), Expect = 0.42 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = +2 Query: 5 LWPDYDFSVDLEEELTRMNINTTAPSPVENKLKLGLDKIIEDIQNILKRKTAYLKGLILN 184 +W S+ + EE + ++ P N +GL+K E I N+L R A L LN Sbjct: 119 MWSSVSSSMQMAEECMKQ-VDDDVPFLNHNNALIGLEKFAETIDNVLNRIRAKLTNTTLN 177 >AE014296-511|AAF47687.1| 1906|Drosophila melanogaster CG1241-PA protein. Length = 1906 Score = 32.7 bits (71), Expect = 0.42 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = +2 Query: 5 LWPDYDFSVDLEEELTRMNINTTAPSPVENKLKLGLDKIIEDIQNILKRKTAYLKGLILN 184 +W S+ + EE + ++ P N +GL+K E I N+L R A L LN Sbjct: 119 MWSSVSSSMQMAEECMKQ-VDDDVPFLNHNNALIGLEKFAETIDNVLNRIRAKLTNTTLN 177 >AE014297-110|AAF52119.1| 975|Drosophila melanogaster CG9783-PA protein. Length = 975 Score = 28.3 bits (60), Expect = 9.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 29 VDLEEELTRMNINTTAPSPVENKLKLGLDKIIEDIQNI 142 +D+E + T +N PS V KLK+GL E+ ++ Sbjct: 366 LDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEFSDV 403 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,829,979 Number of Sequences: 53049 Number of extensions: 430660 Number of successful extensions: 765 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 765 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2641708800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -