BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20995 (720 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 24 1.4 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 23 1.9 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 23 3.3 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 23.8 bits (49), Expect = 1.4 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = +2 Query: 20 CNLNYMYMFRHI*YDFIIINNVIYFVTFAKVKVI 121 CNL + + + + Y III+ I+ T + +++ Sbjct: 220 CNLTFSWYSKKVFYSKIIISGSIFMTTTSFYRIL 253 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 255 ARYDAEMCCTTLVIYRQTEPQRYKYAN 335 A D + T L+ + Q +P R+KY N Sbjct: 66 AGLDPKAMYTVLLEFVQIDPHRWKYVN 92 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 22.6 bits (46), Expect = 3.3 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +2 Query: 20 CNLNYMYMFRHI*YDFIIINNVIYFVTFAKVKV 118 C +YMY F HI + F I + I + V V Sbjct: 63 CFNSYMYAFTHIFFFFAICCDFIALIVVNIVHV 95 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,159 Number of Sequences: 336 Number of extensions: 3111 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -