BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20995 (720 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F3.01 ||SPAC323.09|mannosyltransferase complex subunit |Sch... 27 2.7 SPAC19G12.14 |its3||1-phosphatidylinositol-4-phosphate 5-kinase ... 26 6.2 >SPAC2F3.01 ||SPAC323.09|mannosyltransferase complex subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 319 Score = 27.1 bits (57), Expect = 2.7 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 550 IWRMRCVKERWTHLVNLCDMKERDE 624 +W+ + ERW++ VN C + DE Sbjct: 71 LWKDENIPERWSNTVNSCRRQHPDE 95 >SPAC19G12.14 |its3||1-phosphatidylinositol-4-phosphate 5-kinase Its3|Schizosaccharomyces pombe|chr 1|||Manual Length = 742 Score = 25.8 bits (54), Expect = 6.2 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 342 DRGSRIYSAGALFDGILPK*YNTSRRRSARQFSVLTR 232 DRG+ + ++G+L DGI P + S + +Q V R Sbjct: 208 DRGTNVSTSGSLLDGIPPDIGSASWAEAVKQKRVNMR 244 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,628,502 Number of Sequences: 5004 Number of extensions: 49386 Number of successful extensions: 96 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 337208592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -