BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20994 (695 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38612| Best HMM Match : TSP_1 (HMM E-Value=3.3e-11) 29 4.8 SB_22380| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_57208| Best HMM Match : Ion_trans (HMM E-Value=5.5e-34) 28 8.3 >SB_38612| Best HMM Match : TSP_1 (HMM E-Value=3.3e-11) Length = 900 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = +1 Query: 259 QHVLRPEEDLHWLESGGNVFVQKEKVSHRLPALLIDNNRACKYEHGGT 402 Q +L P + ++ GN+ +LP + D N+ C+ ++G T Sbjct: 291 QAILSPNKCTELNDTPGNIVHYPSSWHDKLPGHIYDRNKQCQMQYGST 338 >SB_22380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 390 TRRDVTRSLHGNQLIAKRHPEMYRNTSIILRQP 488 TRR VT ++ + RH M+ I+ QP Sbjct: 482 TRRQVTHNVRSQHSVMSRHNSMHNRFGIVCHQP 514 >SB_57208| Best HMM Match : Ion_trans (HMM E-Value=5.5e-34) Length = 722 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/58 (25%), Positives = 29/58 (50%) Frame = +2 Query: 206 VSIKATMTGLDPTEVYYVNMCCGRRRICTGSSPAETSSCRKRRFHTDFPLC*STTTAP 379 +++++ +T LDPT + +++ C + TGS+ T + FP S T +P Sbjct: 483 IALRSLITALDPTLISLLDVMCKLEGMGTGSATTSTPR-MQHALPITFPSAVSGTISP 539 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,528,525 Number of Sequences: 59808 Number of extensions: 534155 Number of successful extensions: 1077 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 953 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1060 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -