BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20994 (695 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g21250.1 68416.m02685 ABC transporter family protein similar ... 29 3.9 At1g29740.1 68414.m03636 leucine-rich repeat family protein / pr... 27 9.0 >At3g21250.1 68416.m02685 ABC transporter family protein similar to MRP-like ABC transporter GB:AAC49791 from [Arabidopsis thaliana] Length = 1294 Score = 28.7 bits (61), Expect = 3.9 Identities = 31/122 (25%), Positives = 51/122 (41%) Frame = +1 Query: 31 NLAAERVTILCCLCCHGYCHPGPDRSLLTMELTLDPTGQY*TRLYPFLLEMLKVLDPTGQ 210 N+ +L L GY PG L+ LTL T + TR Y L + ++ Q Sbjct: 959 NVTLFTCALLLILIPKGYIAPGLVGLSLSYALTLTQTQVFLTRWYCTLSNSIISVERIKQ 1018 Query: 211 Y*SNHDRPGPHRSVLCQHVLRPEEDLHWLESGGNVFVQKEKVSHRLPALLIDNNRACKYE 390 Y + + P +++ RP W S G + +Q+ K+ +R A L+ +C + Sbjct: 1019 YMNIPEEP---PAIIDDK--RPPSS--W-PSNGTIHLQELKIRYRPNAPLVLKGISCTFR 1070 Query: 391 HG 396 G Sbjct: 1071 EG 1072 >At1g29740.1 68414.m03636 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1049 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 467 FDYLETTSLVKFKYNADSRYATLRPTMIE 553 FD +E ++K S+ TLRPTM E Sbjct: 885 FDVMEAERMIKVSLLCSSKSPTLRPTMSE 913 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,148,162 Number of Sequences: 28952 Number of extensions: 361919 Number of successful extensions: 717 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 717 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -