BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20989 (773 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 2.1 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 22 6.3 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 8.3 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +3 Query: 597 KDLAGRNVESCFSLAVKQSK-PAVLNVLGSVTIR 695 + L +N E CFSL +K K P L + V ++ Sbjct: 515 RTLGNQNSEMCFSLKLKNKKLPPFLAEIWDVDLK 548 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 386 RRSYIKARPRFGLATVDL 439 + SY+KA+ G+A VDL Sbjct: 398 KASYVKAKGLGGIAIVDL 415 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 8.3 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = -1 Query: 143 SGIRNIQGHTITHFLEGQREHTSVN 69 + +RN+Q HT ++ ++ H N Sbjct: 102 NSVRNVQQHTFADLIQLEQIHLDDN 126 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,858 Number of Sequences: 336 Number of extensions: 3941 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -