BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20989 (773 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC609.01 |||ribonuclease II |Schizosaccharomyces pombe|chr 2||... 26 5.2 SPAC25G10.01 ||SPAC2C4.18|RNA-binding protein|Schizosaccharomyce... 25 9.1 >SPBC609.01 |||ribonuclease II |Schizosaccharomyces pombe|chr 2|||Manual Length = 1157 Score = 26.2 bits (55), Expect = 5.2 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 81 MFPLTLQEMCNRVTLNISDS*AFRCAHSTFNC 176 + LTL+ MCN I S A +H F+C Sbjct: 865 LLQLTLRRMCNESEYTIGTSNAKDVSHFVFSC 896 >SPAC25G10.01 ||SPAC2C4.18|RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 297 Score = 25.4 bits (53), Expect = 9.1 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -3 Query: 504 TPIFRNINGR-FKIILLYVEQKKRSTVAKPNRGRALIYERRR 382 T N+N + F +L V++ KRS P G+ + Y+RRR Sbjct: 156 TSAIDNLNSQEFYGRVLNVQKAKRSRPHSPTPGKYMGYDRRR 197 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,168,039 Number of Sequences: 5004 Number of extensions: 66178 Number of successful extensions: 131 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 131 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 373338084 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -