BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20988 (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1285| Best HMM Match : SET (HMM E-Value=0.011) 31 0.66 SB_35532| Best HMM Match : Peptidase_S49 (HMM E-Value=2.7) 31 0.87 SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_48596| Best HMM Match : Filament (HMM E-Value=0.23) 30 2.0 SB_49487| Best HMM Match : Zip (HMM E-Value=0.014) 29 2.7 SB_56545| Best HMM Match : Exonuc_X-T (HMM E-Value=1.2e-09) 29 3.5 SB_37350| Best HMM Match : MFS_1 (HMM E-Value=4.9e-07) 29 4.7 SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_20714| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_24312| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_346| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_59217| Best HMM Match : TRAUB (HMM E-Value=0.25) 28 8.1 SB_42335| Best HMM Match : Hint (HMM E-Value=1.4013e-45) 28 8.1 SB_39387| Best HMM Match : Lipase_GDSL (HMM E-Value=0.038) 28 8.1 SB_15895| Best HMM Match : Hint (HMM E-Value=1.4013e-45) 28 8.1 >SB_1285| Best HMM Match : SET (HMM E-Value=0.011) Length = 829 Score = 31.5 bits (68), Expect = 0.66 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +2 Query: 254 KNVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAE-KIVSSVKNDIYTAGIAL 430 K V + EE+ R LV L GPP + T+ P E ++S VK ++ + G L Sbjct: 554 KKYSVAEFREELVRQLVGLEEFGPPPAHKPPTRAPNQFETVHMPMMSDVKRNLLSRGADL 613 >SB_35532| Best HMM Match : Peptidase_S49 (HMM E-Value=2.7) Length = 149 Score = 31.1 bits (67), Expect = 0.87 Identities = 21/74 (28%), Positives = 42/74 (56%), Gaps = 1/74 (1%) Frame = +3 Query: 48 RSSIPDKVPEAEDKPLNVVDNLSSEQELIDQ-ANTIKDIDNSLRANKKEVIDIPVKVIVE 224 + SIP P+ + K LN V+N++ +E ++ A+ + D+ N + + K E V V+ Sbjct: 72 KDSIPLAKPQKQQKVLNAVENINWPEEKKERFADVLNDVHN-ISSEKSEEEGDGVVFFVK 130 Query: 225 EIKPSLKSDLKTLK 266 +K + +++L+ LK Sbjct: 131 SLKWA-RNELRILK 143 >SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 30.7 bits (66), Expect = 1.2 Identities = 22/84 (26%), Positives = 46/84 (54%) Frame = +3 Query: 33 RARRTRSSIPDKVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVK 212 R R+ ++ +KV E+ D + ++N EL +Q IK+ + L+ +KE+ + K Sbjct: 593 RDRQIQNLSLEKVNESRDDEITELEN-----ELEEQREIIKENEEKLKEKEKEIEKLKKK 647 Query: 213 VIVEEIKPSLKSDLKTLKCRMKMR 284 +I E+ LK D++T + +++ + Sbjct: 648 II--ELSDKLK-DMETSRNKVETK 668 >SB_48596| Best HMM Match : Filament (HMM E-Value=0.23) Length = 458 Score = 29.9 bits (64), Expect = 2.0 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 3/85 (3%) Frame = +3 Query: 36 ARRTRSSIPDKVPEAEDKPLNVVDNL--SSEQELIDQANTIKDIDNSLRANKKEVIDIPV 209 A R+R D +A L + + SS ++LID I+D ++S +KE + + Sbjct: 124 AMRSRGDTTDAEIKALKTQLKMAEETRDSSRRDLIDAHRKIRDAEDSKETLRKENLHVKR 183 Query: 210 KV-IVEEIKPSLKSDLKTLKCRMKM 281 +V +E K SL+ + L+ ++K+ Sbjct: 184 QVKDLEMEKQSLEKSVSDLREKVKL 208 >SB_49487| Best HMM Match : Zip (HMM E-Value=0.014) Length = 510 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/67 (22%), Positives = 28/67 (41%) Frame = +2 Query: 263 EVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDIYTAGIALRQGF 442 +V ++ I+ LR+ H ++ + HH +KI S + + GF Sbjct: 49 DVSSGSDSIENEKFTLRDDHTDNHHQNHHDHHHHHHHDKKIDSKTSIATVAWMVIVSDGF 108 Query: 443 QEVSDGI 463 +SDG+ Sbjct: 109 HNLSDGL 115 >SB_56545| Best HMM Match : Exonuc_X-T (HMM E-Value=1.2e-09) Length = 416 Score = 29.1 bits (62), Expect = 3.5 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 5/85 (5%) Frame = +3 Query: 144 NTIKDIDNS--LRANKKEVIDIPVKVIVEEIKPSLKSDLKTLKCRMKMRKSRGL*SI*EI 317 N +K + +S +++ K + D+PV +EE D ++ K RGL ++ + Sbjct: 315 NFMKQMKHSQEVKSRKDTLCDLPVSSSMEEKIAKSGMDFNKMRSVYKEGGERGLLTVLAL 374 Query: 318 PGPRS---IKSTKHRILNTTKMLKK 383 P S +K +K R+ T +++ K Sbjct: 375 PPQYSQLNVKGSKPRVTKTIRIINK 399 >SB_37350| Best HMM Match : MFS_1 (HMM E-Value=4.9e-07) Length = 349 Score = 28.7 bits (61), Expect = 4.7 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Frame = -2 Query: 229 ISSTITLTGMSMTSFLFARRLL-SMSLMVLAWSMSSCSLDKLSTTFKGLSSASGTLSGME 53 IS ++ GM+ SFLFA LL + + + S L LS GL + +G+ + ++ Sbjct: 255 ISRSVVRKGMTFLSFLFAATLLVPVGFLNCSQQNISVLLLTLSCGSLGLYAPTGSANSVD 314 Query: 52 LRVRRARI*LA 20 L R A + +A Sbjct: 315 LSPRFAGVTMA 325 >SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1906 Score = 28.7 bits (61), Expect = 4.7 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 5/64 (7%) Frame = +2 Query: 260 VEVPDENEEIKRPLVDLRNPGPPQHQEHETQN---PEHHEDAEKI--VSSVKNDIYTAGI 424 + PDE E + + DL NP + E E Q+ + +D EKI V S +GI Sbjct: 828 INSPDEREIVLSEIYDLDNPSDDEELETEIQDALETANEQDKEKILAVYSALRSPNLSGI 887 Query: 425 ALRQ 436 L Q Sbjct: 888 ELAQ 891 >SB_20714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 494 Score = 28.7 bits (61), Expect = 4.7 Identities = 31/115 (26%), Positives = 47/115 (40%), Gaps = 3/115 (2%) Frame = +3 Query: 114 SSEQELIDQANTIKDIDNSLRANKKEVIDIPVKVIVEEIKPSLKSDLKTLKCRMKMRKSR 293 SSE NT ++NS K ++ V ++ +LK++ LK M + S Sbjct: 5 SSENTPSKATNTALKVENS--TIKAINANLGESVTLKAENAALKAENANLKASMLVDVSA 62 Query: 294 GL*SI*EIPGPRSIKSTKHRILNTTKM---LKKSFLPSKMTFTQRESLFVKASRK 449 + + + HR+ K L+K K TF RESLFV S+K Sbjct: 63 KIGEL-----ENQLSELTHRLAEVVKERDGLRKELGKEKNTFFNRESLFVTLSQK 112 >SB_24312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 787 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +2 Query: 254 KNVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAE-KIVSSVKND 406 K V + EE+ R LV L GPP + T+ P E ++S VK + Sbjct: 554 KKYSVAEFREELVRQLVGLEEFGPPPAHKPPTRAPNQFETVHMPMMSDVKRN 605 >SB_346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 28.3 bits (60), Expect = 6.2 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 3/65 (4%) Frame = +2 Query: 317 PGPPQHQEHETQNPEHHEDAEKIVSSVKN---DIYTAGIALRQGFQEVSDGIGKWYARTE 487 P PP H + E H E E+I S K+ D+ A L++ +++ + +G Y R Sbjct: 282 PNPPPHLDEEKIKQLHEELKEEIKSMAKDSEKDLEDAKKDLKEEIEQIKEEVG--YLRYM 339 Query: 488 QINEL 502 + +L Sbjct: 340 EAKQL 344 >SB_59217| Best HMM Match : TRAUB (HMM E-Value=0.25) Length = 626 Score = 27.9 bits (59), Expect = 8.1 Identities = 22/89 (24%), Positives = 41/89 (46%), Gaps = 2/89 (2%) Frame = +3 Query: 3 TTRGPVANYIRARRTRSSIPDKVPEAE--DKPLNVVDNLSSEQELIDQANTIKDIDNSLR 176 T + +++ +P V + +KP++ +S ++ + ++D NSL Sbjct: 3 TPKAETEEIVKSSENSKKVPSSVVGVDKGNKPVS-----TSPKKTVRTVKEVEDEKNSLD 57 Query: 177 ANKKEVIDIPVKVIVEEIKPSLKSDLKTL 263 K I V+ IVEE+KP L + + TL Sbjct: 58 GEPKLGITRTVE-IVEEVKPELVAKVATL 85 >SB_42335| Best HMM Match : Hint (HMM E-Value=1.4013e-45) Length = 825 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 455 LTLPGSLDEERFPLCKCHF*RKKRFFQHLR 366 +T+P EE+ P+C H +K+F +HLR Sbjct: 539 VTVPARECEEKEPICIRHKLERKKFNKHLR 568 >SB_39387| Best HMM Match : Lipase_GDSL (HMM E-Value=0.038) Length = 155 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 455 LTLPGSLDEERFPLCKCHF*RKKRFFQHLR 366 +T+P EE+ P+C H +K+F +HLR Sbjct: 65 VTVPARECEEKEPICIRHKLERKKFNKHLR 94 >SB_15895| Best HMM Match : Hint (HMM E-Value=1.4013e-45) Length = 561 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 455 LTLPGSLDEERFPLCKCHF*RKKRFFQHLR 366 +T+P EE+ P+C H +K+F +HLR Sbjct: 275 VTVPARECEEKEPICIRHKLERKKFNKHLR 304 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,091,992 Number of Sequences: 59808 Number of extensions: 372514 Number of successful extensions: 1365 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1360 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -