BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20985 (705 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 77 1e-14 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 7e-12 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 67 1e-11 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 64 1e-10 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 58 9e-09 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 48 1e-05 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 42 4e-04 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 42 5e-04 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 42 5e-04 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 38 0.010 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 35 0.056 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.074 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 34 0.13 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 33 0.17 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 31 0.69 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 31 0.91 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 30 2.1 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) 29 3.7 SB_25016| Best HMM Match : PDZ (HMM E-Value=5.6e-08) 29 4.9 SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 28 6.4 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 28 8.5 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 96.3 bits (229), Expect = 2e-20 Identities = 50/139 (35%), Positives = 72/139 (51%), Gaps = 1/139 (0%) Frame = +1 Query: 259 QPFNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPTQYFEEANFPDYVQQGVKT 438 +PFNKNFY+ HP + K+S E+++ R K + VSG P F F + + ++ Sbjct: 475 KPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDEQMMASIRK 534 Query: 439 MGYKEPTPIQAQGWPIAMSGKNLVA*PNGFRQNVGLHLASHCAH-K*PTAIRRGDGPIAL 615 + Y +PT IQ Q PIA+SG++++ L H ++ GDGPI L Sbjct: 535 LEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLWPALVHIMDQPELQVGDGPIVL 594 Query: 616 VLAPTRELAQQIQQVAADF 672 + APTREL QQI A F Sbjct: 595 ICAPTRELCQQIYTEARRF 613 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 77.0 bits (181), Expect = 1e-14 Identities = 50/125 (40%), Positives = 64/125 (51%) Frame = +1 Query: 307 RSPYEVEEYRNKHEVTVSGVEVHNPTQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 486 R +EV+ YR ++TV+G V P FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ---F 113 Query: 487 AMSGKNLVA*PNGFRQNVGLHLASHCAHK*PTAIRRGDGPIALVLAPTRELAQQIQQVAA 666 + G H H+ ++ GDGPI LVL PTRELAQQ+Q+VA Sbjct: 114 ILPG------------------IVHINHQ--PLLQPGDGPIVLVLCPTRELAQQVQEVAY 153 Query: 667 DFWTH 681 H Sbjct: 154 SVGKH 158 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 Query: 545 YILPAIVHINNQPL 586 +ILP IVHIN+QPL Sbjct: 113 FILPGIVHINHQPL 126 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 60.5 bits (140), Expect(2) = 7e-12 Identities = 30/86 (34%), Positives = 48/86 (55%), Gaps = 1/86 (1%) Frame = +1 Query: 259 QPFNKNFYDPHPTVLKRSPYEVEEYRNKHE-VTVSGVEVHNPTQYFEEANFPDYVQQGVK 435 QPF K+FY P + K +P E +E+R E + V G P + + + + +K Sbjct: 62 QPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILDVLK 121 Query: 436 TMGYKEPTPIQAQGWPIAMSGKNLVA 513 Y++PTPIQAQ P+ MSG++++A Sbjct: 122 KNSYEKPTPIQAQAIPVIMSGRDMIA 147 Score = 27.5 bits (58), Expect(2) = 7e-12 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 586 IRRGDGPIALVLAPTRELAQQIQQVAADF 672 I G IA+V+ PTRELA QI + F Sbjct: 139 IMSGRDMIAIVMTPTRELAIQIHRECKKF 167 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 66.9 bits (156), Expect = 1e-11 Identities = 40/143 (27%), Positives = 67/143 (46%), Gaps = 1/143 (0%) Frame = +1 Query: 265 FNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPTQYFEEANFPDYVQQGVKTMG 444 F ++YD + V + S V+E R K+ + + G + P + F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 445 YKEPTPIQAQGWPIAMSGKNLVA-*PNGFRQNVGLHLASHCAHK*PTAIRRGDGPIALVL 621 ++ PTPIQ Q MSG++++ G + + L + GD P+AL+L Sbjct: 92 FQVPTPIQMQSLSCVMSGRDIIGLAETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALIL 151 Query: 622 APTRELAQQIQQVAADFWTHILC 690 PTREL QQ+ ++ I C Sbjct: 152 TPTRELMQQVFMNVSEMLDVIRC 174 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 63.7 bits (148), Expect = 1e-10 Identities = 40/120 (33%), Positives = 61/120 (50%), Gaps = 6/120 (5%) Frame = +1 Query: 331 YRNKHEVTVSGVEVHNPTQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 510 +R ++ G + P + ++EA PD + + V +GYK+PTPIQ Q PI + ++++ Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDII 142 Query: 511 A*P---NGFRQNVGLHLASHCAHK*PTAIRRGD---GPIALVLAPTRELAQQIQQVAADF 672 +G + L P R D GP AL+LAPTRELAQQI++ F Sbjct: 143 GVAETGSGKTAAFAIPLLVWIMGL-PKIERDNDADQGPYALILAPTRELAQQIEEEILKF 201 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 57.6 bits (133), Expect = 9e-09 Identities = 25/77 (32%), Positives = 44/77 (57%) Frame = +1 Query: 280 YDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPTQYFEEANFPDYVQQGVKTMGYKEPT 459 Y HPT+ + +V++ R+K E+ V G V +P F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 460 PIQAQGWPIAMSGKNLV 510 PIQ Q P+ +SG++++ Sbjct: 221 PIQMQVLPVLLSGRDVM 237 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 52.4 bits (120), Expect = 3e-07 Identities = 39/122 (31%), Positives = 56/122 (45%), Gaps = 5/122 (4%) Frame = +1 Query: 355 VSGVEVHNPTQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA*PNGFRQ 534 VSG F E F + + + GY+ PTP+Q PI M+G++L+A Q Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLMA----CAQ 524 Query: 535 NVGLHLASHCAHK*PTAIRRG-----DGPIALVLAPTRELAQQIQQVAADFWTHILCS*H 699 A++ + I++G P+AL +APTRELA+QI A F H Sbjct: 525 TGSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEARKFSDHTPIKVC 584 Query: 700 VC 705 VC Sbjct: 585 VC 586 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 48.4 bits (110), Expect = 6e-06 Identities = 39/121 (32%), Positives = 58/121 (47%), Gaps = 5/121 (4%) Frame = +1 Query: 325 EEYRNKHEVTVSGVEVHNPTQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN 504 E+Y ++ EV VSG FEEAN + V+ YK+PTP+Q PI ++G++ Sbjct: 692 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRD 750 Query: 505 LVA-*PNGFRQNVGLHL----ASHCAHK*PTAIRRGDGPIALVLAPTRELAQQIQQVAAD 669 ++A G + L + A ++ P A+ +APTRELA QI A Sbjct: 751 VMACAQTGSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQIYLEARK 810 Query: 670 F 672 F Sbjct: 811 F 811 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +2 Query: 515 SQTGSGKTLAYILPAIVHINNQPL 586 +QTGSGKT A++LP + + N L Sbjct: 755 AQTGSGKTAAFLLPVMTSMMNAGL 778 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 4/64 (6%) Frame = +1 Query: 319 EVEEYRNKHEVTVSGVEVHNPTQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 486 ++ +R++ + V G +V +P + F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 Query: 487 AMSG 498 G Sbjct: 197 MAHG 200 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 42.3 bits (95), Expect = 4e-04 Identities = 23/63 (36%), Positives = 36/63 (57%) Frame = +1 Query: 325 EEYRNKHEVTVSGVEVHNPTQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN 504 E+Y ++ EV VSG FEEAN + V+ YK+PTP+Q PI ++G++ Sbjct: 115 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRD 173 Query: 505 LVA 513 ++A Sbjct: 174 VMA 176 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 41.9 bits (94), Expect = 5e-04 Identities = 27/98 (27%), Positives = 46/98 (46%) Frame = +1 Query: 391 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA*PNGFRQNVGLHLASHCAH 570 FE+ + G+ G+ +P+PIQ + P+A++G++++A +L Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLLER 108 Query: 571 K*PTAIRRGDGPIALVLAPTRELAQQIQQVAADFWTHI 684 T + ALVL PTRELA Q Q+ + H+ Sbjct: 109 TDTTK----NCIQALVLVPTRELALQTSQICIELGKHM 142 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 41.9 bits (94), Expect = 5e-04 Identities = 27/98 (27%), Positives = 46/98 (46%) Frame = +1 Query: 391 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA*PNGFRQNVGLHLASHCAH 570 FE+ + G+ G+ +P+PIQ + P+A++G++++A +L Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLLER 108 Query: 571 K*PTAIRRGDGPIALVLAPTRELAQQIQQVAADFWTHI 684 T + ALVL PTRELA Q Q+ + H+ Sbjct: 109 TDTTK----NCIQALVLVPTRELALQTSQICIELGKHM 142 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 37.9 bits (84), Expect = 0.008 Identities = 27/91 (29%), Positives = 43/91 (47%) Frame = +1 Query: 433 KTMGYKEPTPIQAQGWPIAMSGKNLVA*PNGFRQNVGLHLASHCAHK*PTAIRRGDGPIA 612 +T G+++P+ IQ + + G++++A S T +R P A Sbjct: 13 ETEGFEKPSAIQQRAIKPILKGRDVIAQAQSGTGKTATFSIS-VLQAIDTQLRE---PQA 68 Query: 613 LVLAPTRELAQQIQQVAADFWTHILCS*HVC 705 LVL+PTRELA QIQ+V ++ H C Sbjct: 69 LVLSPTRELANQIQKVVLALGDYMSVQCHAC 99 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 37.5 bits (83), Expect = 0.010 Identities = 21/34 (61%), Positives = 24/34 (70%), Gaps = 2/34 (5%) Frame = +1 Query: 610 ALVLAPTRELAQQIQQV--AADFWTHILCS*HVC 705 ALVLAPTRELAQQIQ+V A + H+ C H C Sbjct: 162 ALVLAPTRELAQQIQKVVLALGDYMHVKC--HAC 193 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 37.5 bits (83), Expect = 0.010 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 3/81 (3%) Frame = +1 Query: 427 GVKTMGYKEPTPIQAQGWPIAMSGKNLV-A*PNGFRQNVG--LHLASHCAHK*PTAIRRG 597 G+ G+ PT IQ QG P+A+SG++++ A G + + + + + T++ Sbjct: 64 GLMKAGFVTPTDIQKQGIPVALSGRDVLGAAKTGSGKTLAFLIPIIETLWRQKWTSM--- 120 Query: 598 DGPIALVLAPTRELAQQIQQV 660 DG ALV++PTRELA Q +V Sbjct: 121 DGLGALVISPTRELAYQTFEV 141 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 35.1 bits (77), Expect = 0.056 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = +1 Query: 604 PIALVLAPTRELAQQIQQVAADFWTHILCS*HVC 705 P ALVL+PTRELA QIQ+V ++ H C Sbjct: 4 PQALVLSPTRELANQIQKVVLALGDYMSVQCHAC 37 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 34.7 bits (76), Expect = 0.074 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 2/88 (2%) Frame = +1 Query: 424 QGVKTMGYKEPTPIQAQGWPIAMSGKNLV-A*PNGFRQNVGLHL-ASHCAHK*PTAIRRG 597 QG+K MG+ T IQ + + G++L+ A G + + + +K R G Sbjct: 585 QGIKDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKTLAFLVPVVELLYKLQFKTRNG 644 Query: 598 DGPIALVLAPTRELAQQIQQVAADFWTH 681 G I +++PTREL+ Q VA D H Sbjct: 645 TGVI--IISPTRELSLQTYGVARDLLKH 670 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 33.9 bits (74), Expect = 0.13 Identities = 31/119 (26%), Positives = 52/119 (43%), Gaps = 5/119 (4%) Frame = +1 Query: 340 KHEVTVSGVEVHNP---TQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK--N 504 KHEV V + +P + FEE +++GV MG+ +P+ IQ P+ ++ N Sbjct: 85 KHEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLADPPVN 144 Query: 505 LVA*PNGFRQNVGLHLASHCAHK*PTAIRRGDGPIALVLAPTRELAQQIQQVAADFWTH 681 ++A + + + T P + L+PT ELA+Q +VA H Sbjct: 145 MIAQSQSGTGKTAAFVLTMLSRVDATK----PYPQVICLSPTYELARQTGKVAEAMGKH 199 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 33.5 bits (73), Expect = 0.17 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 3/78 (3%) Frame = +1 Query: 424 QGVKTMGYKEPTPIQAQGWPIAMSGKNLVA*P---NGFRQNVGLHLASHCAHK*PTAIRR 594 + V +G+ PTPIQA P+A+ GK++ A G L + ++ PT + Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGKDVCACAATGTGKTAAFMLPILERLLYR-PT---Q 78 Query: 595 GDGPIALVLAPTRELAQQ 648 LV+ PTRELA Q Sbjct: 79 SPAIRVLVITPTRELAIQ 96 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 33.5 bits (73), Expect = 0.17 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 391 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 513 FE+ + + + V GYK+PTP+Q PI ++L+A Sbjct: 877 FEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMA 917 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 31.5 bits (68), Expect = 0.69 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +1 Query: 589 RRGDGPIALVLAPTRELAQQI 651 +RG P LV+APTRELA+Q+ Sbjct: 143 KRGRAPKVLVMAPTRELAKQV 163 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 31.1 bits (67), Expect = 0.91 Identities = 24/81 (29%), Positives = 37/81 (45%) Frame = +1 Query: 409 PDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA*PNGFRQNVGLHLASHCAHK*PTAI 588 P V++ +K MG +P PIQ + P S K+L+ + G P+ Sbjct: 169 PKLVEK-LKKMGITKPVPIQEKALPSVFSHKSLL-----IKSETGT--GKSLVFLLPSVQ 220 Query: 589 RRGDGPIALVLAPTRELAQQI 651 G G +++ PTRELA Q+ Sbjct: 221 DPGRGYGTIIVVPTRELASQM 241 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 515 SQTGSGKTLAYILPAIVHINNQPLFGEVMVRL 610 +QTGSGKTLAY+ P + + ++ RL Sbjct: 422 AQTGSGKTLAYLAPLVHRLREDEERHGILARL 453 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +1 Query: 367 EVHNPTQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 480 ++H P + + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +2 Query: 515 SQTGSGKTLAYILPAIVHI 571 ++TGSGKTLA+ +P I HI Sbjct: 175 AETGSGKTLAFGIPIIQHI 193 >SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 197 HQSLQILQIYCHRCQTETNYRRICCLLQIWNHRFHGY 87 H L YC RC T CCLLQ++++ ++G+ Sbjct: 484 HLQQPSLAAYC-RCITILTTAIACCLLQVYHNTYNGH 519 >SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) Length = 505 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +1 Query: 313 PYEVEEYRNKHEVTVSGVEVHNPTQYFEEANFPDYVQQGVKTMG 444 P+E + + KH++ V+ VE + Q +E F + ++Q VK G Sbjct: 252 PFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQ-VKDTG 294 >SB_25016| Best HMM Match : PDZ (HMM E-Value=5.6e-08) Length = 816 Score = 28.7 bits (61), Expect = 4.9 Identities = 19/75 (25%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = +1 Query: 286 PHPTVLKRSPYEVEEYRNK-HEVTVSGVEVHNPTQYFEEANFPDYVQQGVKTMGYKEPTP 462 P P V + S Y +Y H S ++ T + ++ P Y+QQ ++ +G Sbjct: 341 PPPLVNQISQYNGSQYNQSLHYSLPSTFQISPVTPSLQPSSVPFYLQQDLEALGRISQPR 400 Query: 463 IQAQGWPIAMSGKNL 507 + Q P+A SG+ + Sbjct: 401 VSPQSRPLA-SGQQV 414 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -3 Query: 262 VGVNRIPIWASHVLPSREF 206 VGV I WAS++LPSR+F Sbjct: 10 VGVRDIEQWASNLLPSRQF 28 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 325 EEYRNK-HEVTVSGVEVHNPTQYFEEANFPDY 417 EE NK H++ + + +HNP YFE+ + DY Sbjct: 234 EEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 524 GSGKTLAYILPAIVHINNQPLFGEV 598 GSGK LAY+LP I I ++ E+ Sbjct: 234 GSGKRLAYLLPIIHQITESSVYQEL 258 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,358,997 Number of Sequences: 59808 Number of extensions: 463290 Number of successful extensions: 1238 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 1138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1226 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -