BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20982 (710 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 8.7 AB201717-1|BAD90662.1| 107|Apis mellifera apime-corazonin prepr... 21 8.7 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.4 bits (43), Expect = 8.7 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = -1 Query: 365 STKQYLALNNDRSISFTGVGAGLRCMSNIVKETYD 261 +TKQ N + +S + + NI KE YD Sbjct: 541 ATKQIKDEANKKGVSLRFYNVVYKLIDNIKKEIYD 575 >AB201717-1|BAD90662.1| 107|Apis mellifera apime-corazonin preprohormone protein. Length = 107 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 271 SLTMLDMHRRPAPT 312 S M++ HR+PAPT Sbjct: 90 SENMINDHRQPAPT 103 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,578 Number of Sequences: 438 Number of extensions: 3881 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -