BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20978 (749 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 27 0.19 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 27 0.19 AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 27 0.19 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 25 1.0 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 24 1.8 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 4.0 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 4.0 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 5.3 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 27.1 bits (57), Expect = 0.19 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -3 Query: 147 WSMSSCSLDKFSTTFKGLSSASGTLSGMEVRV 52 W+M+ + D+++ KGLS +++G +R+ Sbjct: 141 WTMTMIAFDRYNVIVKGLSGKPLSINGALIRI 172 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 27.1 bits (57), Expect = 0.19 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -3 Query: 147 WSMSSCSLDKFSTTFKGLSSASGTLSGMEVRV 52 W+M+ + D+++ KGLS +++G +R+ Sbjct: 107 WTMTMIAFDRYNVIVKGLSGKPLSINGALIRI 138 >AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodopsin protein. Length = 154 Score = 27.1 bits (57), Expect = 0.19 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -3 Query: 147 WSMSSCSLDKFSTTFKGLSSASGTLSGMEVRV 52 W+M+ + D+++ KGLS +++G +R+ Sbjct: 17 WTMTMIAFDRYNVIVKGLSGKPLSINGALIRI 48 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 24.6 bits (51), Expect = 1.0 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +1 Query: 247 VEDDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQN 363 + D +E E DE + I+ P+V + PP + ET + Sbjct: 167 IVDPVEENETYDEFDTIRIPIVRSLSKSPPNDEGIETDS 205 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 89 EDKPLNVVENLSSEQELIDQANTIKDIDNSL 181 E P+ ++ENL + E ID+ ++ S+ Sbjct: 333 ETMPMELIENLRNHPEYIDETRNYQECKCSI 363 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = +3 Query: 525 HFQENFGAQIQKLNETLHFIKPADTIAAPSVEETQNKAS 641 H + G LN++LHF++ + + SV E ++++ Sbjct: 20 HILDTCGRDTYALNQSLHFVRASLSNLDMSVLECADRSA 58 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = +3 Query: 525 HFQENFGAQIQKLNETLHFIKPADTIAAPSVEETQNKAS 641 H + G LN++LHF++ + + SV E ++++ Sbjct: 110 HILDTCGRDTYALNQSLHFVRASLSNLDMSVLECADRSA 148 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 191 KKEVVDIPVKVIVEEIKPSLKMI 259 KKE+ DI +V VEEI K++ Sbjct: 570 KKEIYDILPEVDVEEILGEAKVL 592 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,210 Number of Sequences: 438 Number of extensions: 3644 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -