BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20973 (392 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 0.95 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 2.2 S78458-1|AAB34402.1| 46|Apis mellifera apamin protein. 20 8.8 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.4 bits (48), Expect = 0.95 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -3 Query: 378 FAEEPPRRRCLALGFRARLQQ*YGGWRAPDGLWTRA 271 F +EPP R + G A ++ G PD +W RA Sbjct: 5 FVKEPPNRVDFSNGTGAVVECQARGNPQPDIIWVRA 40 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.2 bits (45), Expect = 2.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 107 QKTTSSRSEVEINEELQR 160 ++ RS ++INEE+QR Sbjct: 476 RRVAVDRSGIDINEEIQR 493 >S78458-1|AAB34402.1| 46|Apis mellifera apamin protein. Length = 46 Score = 20.2 bits (40), Expect = 8.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 Query: 140 FLLLISTTSFFVTVPNSCGFTA 75 FL +I TS+FVT C A Sbjct: 11 FLSVILITSYFVTPVMPCNCKA 32 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,073 Number of Sequences: 438 Number of extensions: 1477 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9638226 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -