BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20966 (687 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC014431-1|AAH14431.2| 146|Homo sapiens CYB5B protein protein. 66 1e-10 BC004373-1|AAH04373.1| 146|Homo sapiens CYB5B protein protein. 66 1e-10 AB009282-1|BAA23735.1| 146|Homo sapiens cytochrome b5 protein. 66 1e-10 M60174-1|AAA52165.1| 98|Homo sapiens cytochrome b-5 protein. 60 1e-08 M22865-1|AAA35729.1| 134|Homo sapiens protein ( Human cytochrom... 60 1e-08 L39945-1|AAA63169.1| 142|Homo sapiens cytochrome b5 protein. 60 1e-08 CR456990-1|CAG33271.1| 134|Homo sapiens CYB5 protein. 60 1e-08 BC015182-1|AAH15182.1| 134|Homo sapiens cytochrome b5 type A (m... 60 1e-08 AB209617-1|BAD92854.1| 132|Homo sapiens cytochrome b-5 isoform ... 60 1e-08 BC004901-1|AAH04901.1| 445|Homo sapiens fatty acid desaturase 3... 47 5e-05 AF134404-1|AAD31282.1| 445|Homo sapiens delta-6 fatty acid desa... 47 5e-05 AF084560-1|AAG23122.1| 445|Homo sapiens fatty acid desaturase 3... 47 5e-05 BC025380-1|AAH25380.2| 521|Homo sapiens cytochrome b5 reductase... 47 7e-05 AL139232-4|CAI19905.1| 109|Homo sapiens cytochrome b5 reductase... 47 7e-05 AL139232-3|CAI19904.2| 521|Homo sapiens cytochrome b5 reductase... 47 7e-05 AL034347-2|CAI22326.1| 109|Homo sapiens cytochrome b5 reductase... 47 7e-05 AL034347-1|CAI22325.2| 521|Homo sapiens cytochrome b5 reductase... 47 7e-05 AF169803-1|AAF04812.1| 487|Homo sapiens flavohemoprotein b5+b5R... 47 7e-05 BC009011-1|AAH09011.1| 386|Homo sapiens FADS2 protein protein. 45 3e-04 BC007846-1|AAH07846.1| 444|Homo sapiens fatty acid desaturase 1... 45 3e-04 AK222906-1|BAD96626.1| 444|Homo sapiens fatty acid desaturase 1... 45 3e-04 AK074939-1|BAC11305.1| 444|Homo sapiens protein ( Homo sapiens ... 45 3e-04 AK074819-1|BAC11229.1| 501|Homo sapiens protein ( Homo sapiens ... 45 3e-04 AK074754-1|BAC11182.1| 501|Homo sapiens protein ( Homo sapiens ... 45 3e-04 AK027522-1|BAB55173.1| 444|Homo sapiens protein ( Homo sapiens ... 45 3e-04 AK027427-1|BAB55103.1| 444|Homo sapiens protein ( Homo sapiens ... 45 3e-04 AF226273-1|AAF70457.1| 444|Homo sapiens delta-5 fatty acid desa... 45 3e-04 AF199596-1|AAF29378.1| 444|Homo sapiens delta-5 desaturase prot... 45 3e-04 AF126799-1|AAD20018.1| 444|Homo sapiens delta-6 fatty acid desa... 45 3e-04 AF084559-1|AAG23121.1| 444|Homo sapiens fatty acid desaturase 2... 45 3e-04 AF084558-1|AAG23120.1| 444|Homo sapiens fatty acid desaturase 1... 45 3e-04 AC004770-2|AAC23397.1| 444|Homo sapiens BC269730_2 protein. 45 3e-04 BC017049-1|AAH17049.2| 372|Homo sapiens fatty acid 2-hydroxylas... 40 0.006 BC004263-1|AAH04263.2| 372|Homo sapiens fatty acid 2-hydroxylas... 40 0.006 BC002679-1|AAH02679.2| 372|Homo sapiens fatty acid 2-hydroxylas... 40 0.006 AK058016-1|BAB71632.1| 372|Homo sapiens protein ( Homo sapiens ... 40 0.006 L31573-1|AAA74886.1| 488|Homo sapiens sulfite oxidase protein. 32 1.7 BC065193-1|AAH65193.2| 545|Homo sapiens sulfite oxidase protein. 32 1.7 AY056018-1|AAL08048.1| 488|Homo sapiens sulfite oxidase protein. 32 1.7 AF071172-1|AAD08657.1| 4834|Homo sapiens HERC2 protein. 32 1.7 BC060779-1|AAH60779.1| 228|Homo sapiens cytochrome b5 domain co... 31 2.9 AK057061-1|BAB71357.1| 157|Homo sapiens protein ( Homo sapiens ... 31 2.9 AF136523-1|AAD28285.1| 1321|Homo sapiens bile salt export pump p... 31 2.9 AF091582-1|AAC77455.1| 1321|Homo sapiens bile salt export pump p... 31 2.9 >BC014431-1|AAH14431.2| 146|Homo sapiens CYB5B protein protein. Length = 146 Score = 65.7 bits (153), Expect = 1e-10 Identities = 27/57 (47%), Positives = 41/57 (71%) Frame = +2 Query: 515 DCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRSSGHSRMAVKALDRFLV 685 + W+VI+ RVYD++ FL+EHPGG +++LE AG DAS +F GHS A + L ++ + Sbjct: 36 ELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYI 92 >BC004373-1|AAH04373.1| 146|Homo sapiens CYB5B protein protein. Length = 146 Score = 65.7 bits (153), Expect = 1e-10 Identities = 27/57 (47%), Positives = 41/57 (71%) Frame = +2 Query: 515 DCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRSSGHSRMAVKALDRFLV 685 + W+VI+ RVYD++ FL+EHPGG +++LE AG DAS +F GHS A + L ++ + Sbjct: 36 ELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYI 92 >AB009282-1|BAA23735.1| 146|Homo sapiens cytochrome b5 protein. Length = 146 Score = 65.7 bits (153), Expect = 1e-10 Identities = 27/57 (47%), Positives = 41/57 (71%) Frame = +2 Query: 515 DCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRSSGHSRMAVKALDRFLV 685 + W+VI+ RVYD++ FL+EHPGG +++LE AG DAS +F GHS A + L ++ + Sbjct: 36 ELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYI 92 >M60174-1|AAA52165.1| 98|Homo sapiens cytochrome b-5 protein. Length = 98 Score = 59.7 bits (138), Expect = 1e-08 Identities = 23/60 (38%), Positives = 38/60 (63%) Frame = +2 Query: 506 HPDDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRSSGHSRMAVKALDRFLV 685 H W++++ +VYD++ FL+EHPGG +++ E AG DA+ F GHS A + F++ Sbjct: 22 HSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFII 81 >M22865-1|AAA35729.1| 134|Homo sapiens protein ( Human cytochrome b5 mRNA, complete cds. ). Length = 134 Score = 59.7 bits (138), Expect = 1e-08 Identities = 23/60 (38%), Positives = 38/60 (63%) Frame = +2 Query: 506 HPDDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRSSGHSRMAVKALDRFLV 685 H W++++ +VYD++ FL+EHPGG +++ E AG DA+ F GHS A + F++ Sbjct: 22 HSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFII 81 >L39945-1|AAA63169.1| 142|Homo sapiens cytochrome b5 protein. Length = 142 Score = 59.7 bits (138), Expect = 1e-08 Identities = 23/60 (38%), Positives = 38/60 (63%) Frame = +2 Query: 506 HPDDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRSSGHSRMAVKALDRFLV 685 H W++++ +VYD++ FL+EHPGG +++ E AG DA+ F GHS A + F++ Sbjct: 22 HSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFII 81 >CR456990-1|CAG33271.1| 134|Homo sapiens CYB5 protein. Length = 134 Score = 59.7 bits (138), Expect = 1e-08 Identities = 23/60 (38%), Positives = 38/60 (63%) Frame = +2 Query: 506 HPDDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRSSGHSRMAVKALDRFLV 685 H W++++ +VYD++ FL+EHPGG +++ E AG DA+ F GHS A + F++ Sbjct: 22 HSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFII 81 >BC015182-1|AAH15182.1| 134|Homo sapiens cytochrome b5 type A (microsomal) protein. Length = 134 Score = 59.7 bits (138), Expect = 1e-08 Identities = 23/60 (38%), Positives = 38/60 (63%) Frame = +2 Query: 506 HPDDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRSSGHSRMAVKALDRFLV 685 H W++++ +VYD++ FL+EHPGG +++ E AG DA+ F GHS A + F++ Sbjct: 22 HSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFII 81 >AB209617-1|BAD92854.1| 132|Homo sapiens cytochrome b-5 isoform 1 variant protein. Length = 132 Score = 59.7 bits (138), Expect = 1e-08 Identities = 23/60 (38%), Positives = 38/60 (63%) Frame = +2 Query: 506 HPDDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRSSGHSRMAVKALDRFLV 685 H W++++ +VYD++ FL+EHPGG +++ E AG DA+ F GHS A + F++ Sbjct: 43 HSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFII 102 >BC004901-1|AAH04901.1| 445|Homo sapiens fatty acid desaturase 3 protein. Length = 445 Score = 47.2 bits (107), Expect = 5e-05 Identities = 20/43 (46%), Positives = 27/43 (62%) Frame = +2 Query: 509 PDDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRS 637 P D W+VI RVYDIS + HPGG ++ + DA+ AFR+ Sbjct: 34 PGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFRA 76 >AF134404-1|AAD31282.1| 445|Homo sapiens delta-6 fatty acid desaturase protein. Length = 445 Score = 47.2 bits (107), Expect = 5e-05 Identities = 20/43 (46%), Positives = 27/43 (62%) Frame = +2 Query: 509 PDDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRS 637 P D W+VI RVYDIS + HPGG ++ + DA+ AFR+ Sbjct: 34 PGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFRA 76 >AF084560-1|AAG23122.1| 445|Homo sapiens fatty acid desaturase 3 protein. Length = 445 Score = 47.2 bits (107), Expect = 5e-05 Identities = 20/43 (46%), Positives = 27/43 (62%) Frame = +2 Query: 509 PDDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRS 637 P D W+VI RVYDIS + HPGG ++ + DA+ AFR+ Sbjct: 34 PGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFRA 76 >BC025380-1|AAH25380.2| 521|Homo sapiens cytochrome b5 reductase 4 protein. Length = 521 Score = 46.8 bits (106), Expect = 7e-05 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = +2 Query: 512 DDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAF 631 DDCWI I VY++S +++ HPGG D ++ AG D + F Sbjct: 69 DDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELF 108 >AL139232-4|CAI19905.1| 109|Homo sapiens cytochrome b5 reductase 4 protein. Length = 109 Score = 46.8 bits (106), Expect = 7e-05 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = +2 Query: 512 DDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAF 631 DDCWI I VY++S +++ HPGG D ++ AG D + F Sbjct: 35 DDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELF 74 >AL139232-3|CAI19904.2| 521|Homo sapiens cytochrome b5 reductase 4 protein. Length = 521 Score = 46.8 bits (106), Expect = 7e-05 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = +2 Query: 512 DDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAF 631 DDCWI I VY++S +++ HPGG D ++ AG D + F Sbjct: 69 DDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELF 108 >AL034347-2|CAI22326.1| 109|Homo sapiens cytochrome b5 reductase 4 protein. Length = 109 Score = 46.8 bits (106), Expect = 7e-05 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = +2 Query: 512 DDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAF 631 DDCWI I VY++S +++ HPGG D ++ AG D + F Sbjct: 35 DDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELF 74 >AL034347-1|CAI22325.2| 521|Homo sapiens cytochrome b5 reductase 4 protein. Length = 521 Score = 46.8 bits (106), Expect = 7e-05 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = +2 Query: 512 DDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAF 631 DDCWI I VY++S +++ HPGG D ++ AG D + F Sbjct: 69 DDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELF 108 >AF169803-1|AAF04812.1| 487|Homo sapiens flavohemoprotein b5+b5R protein. Length = 487 Score = 46.8 bits (106), Expect = 7e-05 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = +2 Query: 512 DDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAF 631 DDCWI I VY++S +++ HPGG D ++ AG D + F Sbjct: 35 DDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELF 74 >BC009011-1|AAH09011.1| 386|Homo sapiens FADS2 protein protein. Length = 386 Score = 44.8 bits (101), Expect = 3e-04 Identities = 19/41 (46%), Positives = 29/41 (70%) Frame = +2 Query: 515 DCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRS 637 D W+VI +VY+I+ + +HPGG ++ YAG DA+ AFR+ Sbjct: 34 DRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRA 74 >BC007846-1|AAH07846.1| 444|Homo sapiens fatty acid desaturase 1 protein. Length = 444 Score = 44.8 bits (101), Expect = 3e-04 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +2 Query: 512 DDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAF 631 ++ W+VI +VY+IS F HPGG ++ YAG+DA+ F Sbjct: 32 EERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPF 71 >AK222906-1|BAD96626.1| 444|Homo sapiens fatty acid desaturase 1 variant protein. Length = 444 Score = 44.8 bits (101), Expect = 3e-04 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +2 Query: 512 DDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAF 631 ++ W+VI +VY+IS F HPGG ++ YAG+DA+ F Sbjct: 32 EERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPF 71 >AK074939-1|BAC11305.1| 444|Homo sapiens protein ( Homo sapiens cDNA FLJ90458 fis, clone NT2RP3001738, highly similar to Fatty acid desaturase 2. ). Length = 444 Score = 44.8 bits (101), Expect = 3e-04 Identities = 19/41 (46%), Positives = 29/41 (70%) Frame = +2 Query: 515 DCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRS 637 D W+VI +VY+I+ + +HPGG ++ YAG DA+ AFR+ Sbjct: 34 DRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRA 74 >AK074819-1|BAC11229.1| 501|Homo sapiens protein ( Homo sapiens cDNA FLJ90338 fis, clone NT2RP2002527, highly similar to Fatty acid desaturase 1. ). Length = 501 Score = 44.8 bits (101), Expect = 3e-04 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +2 Query: 512 DDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAF 631 ++ W+VI +VY+IS F HPGG ++ YAG+DA+ F Sbjct: 89 EERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPF 128 >AK074754-1|BAC11182.1| 501|Homo sapiens protein ( Homo sapiens cDNA FLJ90273 fis, clone NT2RP1000181, moderately similar to Homo sapiens delta-6 fatty acid desaturase mRNA. ). Length = 501 Score = 44.8 bits (101), Expect = 3e-04 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +2 Query: 512 DDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAF 631 ++ W+VI +VY+IS F HPGG ++ YAG+DA+ F Sbjct: 89 EERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPF 128 >AK027522-1|BAB55173.1| 444|Homo sapiens protein ( Homo sapiens cDNA FLJ14616 fis, clone NT2RP1001313, moderately similar to Homo sapiens delta-6 fatty acid desaturase mRNA. ). Length = 444 Score = 44.8 bits (101), Expect = 3e-04 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +2 Query: 512 DDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAF 631 ++ W+VI +VY+IS F HPGG ++ YAG+DA+ F Sbjct: 32 EERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPF 71 >AK027427-1|BAB55103.1| 444|Homo sapiens protein ( Homo sapiens cDNA FLJ14521 fis, clone NT2RM1000882, moderately similar to Homo sapiens delta-6 fatty acid desaturase mRNA. ). Length = 444 Score = 44.8 bits (101), Expect = 3e-04 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +2 Query: 512 DDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAF 631 ++ W+VI +VY+IS F HPGG ++ YAG+DA+ F Sbjct: 32 EERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPF 71 >AF226273-1|AAF70457.1| 444|Homo sapiens delta-5 fatty acid desaturase protein. Length = 444 Score = 44.8 bits (101), Expect = 3e-04 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +2 Query: 512 DDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAF 631 ++ W+VI +VY+IS F HPGG ++ YAG+DA+ F Sbjct: 32 EERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPF 71 >AF199596-1|AAF29378.1| 444|Homo sapiens delta-5 desaturase protein. Length = 444 Score = 44.8 bits (101), Expect = 3e-04 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +2 Query: 512 DDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAF 631 ++ W+VI +VY+IS F HPGG ++ YAG+DA+ F Sbjct: 32 EERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPF 71 >AF126799-1|AAD20018.1| 444|Homo sapiens delta-6 fatty acid desaturase protein. Length = 444 Score = 44.8 bits (101), Expect = 3e-04 Identities = 19/41 (46%), Positives = 29/41 (70%) Frame = +2 Query: 515 DCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRS 637 D W+VI +VY+I+ + +HPGG ++ YAG DA+ AFR+ Sbjct: 34 DRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRA 74 >AF084559-1|AAG23121.1| 444|Homo sapiens fatty acid desaturase 2 protein. Length = 444 Score = 44.8 bits (101), Expect = 3e-04 Identities = 19/41 (46%), Positives = 29/41 (70%) Frame = +2 Query: 515 DCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRS 637 D W+VI +VY+I+ + +HPGG ++ YAG DA+ AFR+ Sbjct: 34 DRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRA 74 >AF084558-1|AAG23120.1| 444|Homo sapiens fatty acid desaturase 1 protein. Length = 444 Score = 44.8 bits (101), Expect = 3e-04 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +2 Query: 512 DDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAF 631 ++ W+VI +VY+IS F HPGG ++ YAG+DA+ F Sbjct: 32 EERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPF 71 >AC004770-2|AAC23397.1| 444|Homo sapiens BC269730_2 protein. Length = 444 Score = 44.8 bits (101), Expect = 3e-04 Identities = 18/40 (45%), Positives = 27/40 (67%) Frame = +2 Query: 512 DDCWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAF 631 ++ W+VI +VY+IS F HPGG ++ YAG+DA+ F Sbjct: 32 EERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPF 71 >BC017049-1|AAH17049.2| 372|Homo sapiens fatty acid 2-hydroxylase protein. Length = 372 Score = 40.3 bits (90), Expect = 0.006 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +2 Query: 518 CWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRSSGHSRMA 658 CW+ R+YD+S+F+ HPGG ++ AG+D S H A Sbjct: 25 CWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSA 71 >BC004263-1|AAH04263.2| 372|Homo sapiens fatty acid 2-hydroxylase protein. Length = 372 Score = 40.3 bits (90), Expect = 0.006 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +2 Query: 518 CWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRSSGHSRMA 658 CW+ R+YD+S+F+ HPGG ++ AG+D S H A Sbjct: 25 CWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSA 71 >BC002679-1|AAH02679.2| 372|Homo sapiens fatty acid 2-hydroxylase protein. Length = 372 Score = 40.3 bits (90), Expect = 0.006 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +2 Query: 518 CWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRSSGHSRMA 658 CW+ R+YD+S+F+ HPGG ++ AG+D S H A Sbjct: 25 CWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSA 71 >AK058016-1|BAB71632.1| 372|Homo sapiens protein ( Homo sapiens cDNA FLJ25287 fis, clone STM06919. ). Length = 372 Score = 40.3 bits (90), Expect = 0.006 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +2 Query: 518 CWIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRSSGHSRMA 658 CW+ R+YD+S+F+ HPGG ++ AG+D S H A Sbjct: 25 CWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSA 71 >L31573-1|AAA74886.1| 488|Homo sapiens sulfite oxidase protein. Length = 488 Score = 32.3 bits (70), Expect = 1.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 521 WIVIYDRVYDISTFLDEHPGGGDIMLEYAG 610 W+ + V+D++ F+D HPGG ++ AG Sbjct: 44 WVTLGSEVFDVTEFVDLHPGGPSKLMLAAG 73 >BC065193-1|AAH65193.2| 545|Homo sapiens sulfite oxidase protein. Length = 545 Score = 32.3 bits (70), Expect = 1.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 521 WIVIYDRVYDISTFLDEHPGGGDIMLEYAG 610 W+ + V+D++ F+D HPGG ++ AG Sbjct: 101 WVTLGSEVFDVTEFVDLHPGGPSKLMLAAG 130 >AY056018-1|AAL08048.1| 488|Homo sapiens sulfite oxidase protein. Length = 488 Score = 32.3 bits (70), Expect = 1.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 521 WIVIYDRVYDISTFLDEHPGGGDIMLEYAG 610 W+ + V+D++ F+D HPGG ++ AG Sbjct: 44 WVTLGSEVFDVTEFVDLHPGGPSKLMLAAG 73 >AF071172-1|AAD08657.1| 4834|Homo sapiens HERC2 protein. Length = 4834 Score = 32.3 bits (70), Expect = 1.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +2 Query: 521 WIVIYDRVYDISTFLDEHPGGGDIMLEYAGRDASTAFRSS 640 W VI +VYDI F + G I+ ++AG D A ++ Sbjct: 1225 WTVIDGKVYDIKDFQTQSLTGNSILAQFAGEDPVVALEAA 1264 >BC060779-1|AAH60779.1| 228|Homo sapiens cytochrome b5 domain containing 1 protein. Length = 228 Score = 31.5 bits (68), Expect = 2.9 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = +2 Query: 509 PDDCWIVIYDRVYDISTFLDEHPGGGDI--MLEYAGRDASTAF 631 P+D W+ RVYD+++ E+ G + ++E AG+D S F Sbjct: 31 PEDLWVSYLGRVYDLTSLAQEYKGNLLLKPIVEVAGQDISHWF 73 >AK057061-1|BAB71357.1| 157|Homo sapiens protein ( Homo sapiens cDNA FLJ32499 fis, clone SKNSH2000347, weakly similar to CYTOCHROME B2 PRECURSOR (EC 1.1.2.3). ). Length = 157 Score = 31.5 bits (68), Expect = 2.9 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = +2 Query: 509 PDDCWIVIYDRVYDISTFLDEHPGGGDI--MLEYAGRDASTAF 631 P+D W+ RVYD+++ E+ G + ++E AG+D S F Sbjct: 31 PEDLWVSYLGRVYDLTSLAQEYKGNLLLKPIVEVAGQDISHWF 73 >AF136523-1|AAD28285.1| 1321|Homo sapiens bile salt export pump protein. Length = 1321 Score = 31.5 bits (68), Expect = 2.9 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = -3 Query: 400 LTKRKAAIVSAIRSKSAS*FGVGADKFTSLVVCTVVIFAFNFKL 269 LT R A S ++ + S G+ + FT++ V ++ F+F++KL Sbjct: 857 LTTRLATDASQVQGAAGSQIGMIVNSFTNVTVAMIIAFSFSWKL 900 >AF091582-1|AAC77455.1| 1321|Homo sapiens bile salt export pump protein. Length = 1321 Score = 31.5 bits (68), Expect = 2.9 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = -3 Query: 400 LTKRKAAIVSAIRSKSAS*FGVGADKFTSLVVCTVVIFAFNFKL 269 LT R A S ++ + S G+ + FT++ V ++ F+F++KL Sbjct: 857 LTTRLATDASQVQGAAGSQIGMIVNSFTNVTVAMIIAFSFSWKL 900 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,361,125 Number of Sequences: 237096 Number of extensions: 2038457 Number of successful extensions: 3887 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 3816 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3887 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -