BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20963 (745 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 64 1e-10 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 64 1e-10 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 62 3e-10 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 62 4e-10 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 61 7e-10 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 61 7e-10 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 61 9e-10 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 61 9e-10 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 61 9e-10 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 60 2e-09 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 60 2e-09 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 60 2e-09 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 60 2e-09 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 60 2e-09 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 59 3e-09 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 59 3e-09 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 59 3e-09 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 59 3e-09 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 59 3e-09 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 59 3e-09 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 58 6e-09 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 58 6e-09 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 58 8e-09 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 58 8e-09 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 57 1e-08 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 57 1e-08 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 57 1e-08 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 57 1e-08 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 57 1e-08 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 57 1e-08 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 57 1e-08 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 57 1e-08 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 57 1e-08 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 57 1e-08 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 57 1e-08 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 57 1e-08 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 57 1e-08 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 57 1e-08 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 56 2e-08 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 56 2e-08 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 56 2e-08 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 56 2e-08 At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ... 56 2e-08 At1g71800.1 68414.m08298 cleavage stimulation factor, putative s... 56 2e-08 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 55 6e-08 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 55 6e-08 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 55 6e-08 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 54 8e-08 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 54 1e-07 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 54 1e-07 At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, ... 54 1e-07 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 54 1e-07 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 52 3e-07 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 52 3e-07 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 52 3e-07 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 52 3e-07 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 52 4e-07 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 52 5e-07 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 52 5e-07 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 52 5e-07 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 51 9e-07 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 51 9e-07 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 50 1e-06 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 50 1e-06 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 50 1e-06 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 50 1e-06 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 50 2e-06 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 50 2e-06 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 50 2e-06 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 50 2e-06 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 50 2e-06 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 49 3e-06 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 49 3e-06 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 49 4e-06 At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ... 49 4e-06 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 49 4e-06 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 49 4e-06 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 49 4e-06 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 49 4e-06 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 48 7e-06 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 48 7e-06 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 48 7e-06 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 48 9e-06 At5g51300.2 68418.m06360 splicing factor-related contains simila... 47 1e-05 At5g51300.1 68418.m06359 splicing factor-related contains simila... 47 1e-05 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 47 2e-05 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 47 2e-05 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 47 2e-05 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 47 2e-05 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 47 2e-05 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 46 2e-05 At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3... 46 2e-05 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 46 3e-05 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 46 3e-05 At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing ... 46 3e-05 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 46 3e-05 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 46 3e-05 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 46 3e-05 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 45 5e-05 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 45 5e-05 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 45 5e-05 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 45 5e-05 At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 45 5e-05 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 45 5e-05 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 45 5e-05 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 45 5e-05 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 45 5e-05 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 45 5e-05 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 45 6e-05 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 45 6e-05 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 45 6e-05 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 45 6e-05 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 45 6e-05 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 44 8e-05 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 44 1e-04 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 44 1e-04 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 44 1e-04 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 44 1e-04 At2g21690.1 68415.m02580 RNA-binding protein, putative similar t... 44 1e-04 At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ... 43 2e-04 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 43 2e-04 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 43 2e-04 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 42 3e-04 At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing ... 42 4e-04 At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing ... 42 4e-04 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 42 6e-04 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 42 6e-04 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 41 8e-04 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 41 8e-04 At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing ... 41 8e-04 At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing ... 41 0.001 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 41 0.001 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 41 0.001 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 41 0.001 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 41 0.001 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 41 0.001 At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing ... 40 0.001 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 40 0.001 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 40 0.002 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 40 0.002 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 40 0.002 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 39 0.004 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 39 0.004 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 38 0.005 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 38 0.005 At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28... 38 0.007 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 38 0.007 At5g02530.1 68418.m00187 RNA and export factor-binding protein, ... 38 0.009 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 38 0.009 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 38 0.009 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 38 0.009 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 38 0.009 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 38 0.009 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 38 0.009 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 38 0.009 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 38 0.009 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 38 0.009 At5g59950.3 68418.m07518 RNA and export factor-binding protein, ... 37 0.016 At5g59950.2 68418.m07519 RNA and export factor-binding protein, ... 37 0.016 At5g59950.1 68418.m07517 RNA and export factor-binding protein, ... 37 0.016 At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, pu... 37 0.016 At5g48650.1 68418.m06016 nuclear transport factor 2 (NTF2) famil... 36 0.021 At1g45100.1 68414.m05170 polyadenylate-binding protein, putative... 36 0.021 At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi... 36 0.028 At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein... 36 0.028 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 36 0.037 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 35 0.065 At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id... 35 0.065 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 35 0.065 At5g10350.2 68418.m01201 polyadenylate-binding protein family pr... 34 0.087 At5g10350.1 68418.m01200 polyadenylate-binding protein family pr... 34 0.087 At5g65260.1 68418.m08209 polyadenylate-binding protein family pr... 34 0.11 At5g51120.1 68418.m06339 polyadenylate-binding protein, putative... 34 0.11 At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing ... 34 0.11 At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu... 33 0.15 At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonu... 33 0.15 At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-l... 33 0.15 At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-l... 33 0.15 At5g41690.1 68418.m05067 polyadenylate-binding protein, putative... 33 0.20 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 33 0.20 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 33 0.20 At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 32 0.35 At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing ... 32 0.46 At3g48830.1 68416.m05333 polynucleotide adenylyltransferase fami... 32 0.46 At5g37720.1 68418.m04541 RNA and export factor-binding protein, ... 31 0.61 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 31 0.81 At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing ... 31 1.1 At1g79100.1 68414.m09223 arginine/serine-rich protein-related si... 31 1.1 At5g60980.1 68418.m07649 nuclear transport factor 2 (NTF2) famil... 30 1.4 At3g63450.1 68416.m07144 RNA recognition motif (RRM)-containing ... 30 1.4 At2g33440.1 68415.m04099 splicing factor family protein similar ... 30 1.4 At5g66010.1 68418.m08312 heterogeneous nuclear ribonucleoprotein... 30 1.9 At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) famil... 30 1.9 At5g10800.1 68418.m01255 RNA recognition motif (RRM)-containing ... 30 1.9 At3g51950.1 68416.m05698 zinc finger (CCCH-type) family protein ... 30 1.9 At3g07250.1 68416.m00863 nuclear transport factor 2 (NTF2) famil... 29 2.5 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 29 3.3 At5g53470.1 68418.m06645 acyl-CoA binding protein, putative / AC... 29 3.3 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 29 3.3 At5g28810.1 68418.m03542 hypothetical protein 29 4.3 At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing ... 28 5.7 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 28 7.5 At1g72800.1 68414.m08416 nuM1-related contains similarity with n... 28 7.5 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 63.7 bits (148), Expect = 1e-10 Identities = 28/57 (49%), Positives = 36/57 (63%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +++VG LAW LR YF QFG + A V+ D+S+G SKGYGF+ F P AA A Sbjct: 8 KVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKA 64 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 63.7 bits (148), Expect = 1e-10 Identities = 28/57 (49%), Positives = 36/57 (63%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +++VG LAW LR YF QFG + A V+ D+S+G SKGYGF+ F P AA A Sbjct: 8 KVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKA 64 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 62.5 bits (145), Expect = 3e-10 Identities = 25/59 (42%), Positives = 42/59 (71%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +++L++G +A+++ LRE F+++G V RV+ DR TG S+G+GF+ FTS AA+ A Sbjct: 39 SSKLFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSA 97 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 62.1 bits (144), Expect = 4e-10 Identities = 26/57 (45%), Positives = 37/57 (64%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +++VG LAW LR++F Q+G + A V+ D++TG SKGYGF+ F P AA A Sbjct: 25 KVFVGGLAWETQSETLRQHFEQYGEILEAVVIADKNTGRSKGYGFVTFRDPEAARRA 81 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 61.3 bits (142), Expect = 7e-10 Identities = 26/78 (33%), Positives = 46/78 (58%) Frame = +2 Query: 254 SSLHLLEIVSL*VMASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGL 433 SS H L +S + +++L++G L+W+V + L++ FS FG V R+ +D+ +G Sbjct: 23 SSFHFLP--QFCTSSSASPSSKLFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDKGSGR 80 Query: 434 SKGYGFIEFTSPSAAADA 487 S+G+GF++F A A Sbjct: 81 SRGFGFVDFAEEGDALSA 98 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 61.3 bits (142), Expect = 7e-10 Identities = 26/57 (45%), Positives = 36/57 (63%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +++VG LAW LR +F Q+G + A V+ D++TG SKGYGF+ F P AA A Sbjct: 25 KVFVGGLAWETQSETLRRHFDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEAARRA 81 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 60.9 bits (141), Expect = 9e-10 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 6/76 (7%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPS------ 472 A R+YVGNL W V +L FS+ G V ARVV DR TG S+G+GF++ ++ + Sbjct: 206 AFRIYVGNLPWDVDSGRLERLFSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVAI 265 Query: 473 AAADATNKQIHTLKVS 520 AA D N + +KV+ Sbjct: 266 AALDGQNLEGRAIKVN 281 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/61 (36%), Positives = 36/61 (59%) Frame = +2 Query: 314 ARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATN 493 A+L+VGNL + V + L F Q G V+ + V+++R T S+G+GF+ ++ A A Sbjct: 113 AKLFVGNLPYDVDSQALAMLFEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEEAEKAVE 172 Query: 494 K 496 K Sbjct: 173 K 173 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 60.9 bits (141), Expect = 9e-10 Identities = 31/76 (40%), Positives = 45/76 (59%), Gaps = 6/76 (7%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFI------EFTSPS 472 A R+YVGNL W V + +L + FS+ G V ARVV+DR TG S+G+GF+ E Sbjct: 243 AFRVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAI 302 Query: 473 AAADATNKQIHTLKVS 520 +A D N + ++V+ Sbjct: 303 SALDGQNLEGRAIRVN 318 Score = 53.6 bits (123), Expect = 1e-07 Identities = 25/61 (40%), Positives = 37/61 (60%) Frame = +2 Query: 314 ARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATN 493 A+L+VGNLA+ V + L F Q G V+ A V+++R T S+G+GF+ +S A A Sbjct: 150 AKLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVE 209 Query: 494 K 496 K Sbjct: 210 K 210 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 60.9 bits (141), Expect = 9e-10 Identities = 26/60 (43%), Positives = 36/60 (60%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 + +++VG LAW +R YF QFG + A V+ D++TG SKGYGF+ F AA A Sbjct: 20 KLTKIFVGGLAWETQRDTMRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEAAMRA 79 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 60.1 bits (139), Expect = 2e-09 Identities = 27/59 (45%), Positives = 36/59 (61%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATN 493 RLYVGNL+W V L F++ G V ARV++DR +G SKG+GF+ +S A N Sbjct: 250 RLYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAIN 308 Score = 50.4 bits (115), Expect = 1e-06 Identities = 23/63 (36%), Positives = 39/63 (61%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 +L+VGNL++ V QL + F G V+ V++D+ TG S+G+GF+ S +A +A + Sbjct: 100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTM-STAAEVEAAAQ 158 Query: 497 QIH 505 Q + Sbjct: 159 QFN 161 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 60.1 bits (139), Expect = 2e-09 Identities = 27/59 (45%), Positives = 36/59 (61%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATN 493 RLYVGNL+W V L F++ G V ARV++DR +G SKG+GF+ +S A N Sbjct: 258 RLYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAIN 316 Score = 50.4 bits (115), Expect = 1e-06 Identities = 23/63 (36%), Positives = 39/63 (61%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 +L+VGNL++ V QL + F G V+ V++D+ TG S+G+GF+ S +A +A + Sbjct: 100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTM-STAAEVEAAAQ 158 Query: 497 QIH 505 Q + Sbjct: 159 QFN 161 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 59.7 bits (138), Expect = 2e-09 Identities = 23/62 (37%), Positives = 40/62 (64%) Frame = +2 Query: 293 MASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPS 472 M S + +L++G ++W +L+EYF ++G + A ++ DR+TG ++G+GFI F PS Sbjct: 8 MESASDLGKLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDRTTGRARGFGFIVFADPS 67 Query: 473 AA 478 A Sbjct: 68 VA 69 Score = 51.6 bits (118), Expect = 5e-07 Identities = 22/69 (31%), Positives = 37/69 (53%) Frame = +2 Query: 305 ARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAAD 484 AR +++VG L ++ + + YF QFG + V++D +T +G+GFI F S + Sbjct: 119 ARTKKIFVGGLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDM 178 Query: 485 ATNKQIHTL 511 +K H L Sbjct: 179 VLHKTFHEL 187 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 59.7 bits (138), Expect = 2e-09 Identities = 22/54 (40%), Positives = 37/54 (68%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 +L++G ++W +L+EYFS FG V A ++ DR+TG ++G+GF+ F P+ A Sbjct: 7 KLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVA 60 Score = 47.6 bits (108), Expect = 9e-06 Identities = 22/68 (32%), Positives = 33/68 (48%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 R +++VG L +V + YF QFG V++D +T +G+GFI + S A Sbjct: 106 RTRKIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKV 165 Query: 488 TNKQIHTL 511 K H L Sbjct: 166 LLKTFHEL 173 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 59.7 bits (138), Expect = 2e-09 Identities = 22/54 (40%), Positives = 37/54 (68%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 +L++G ++W +L+EYFS FG V A ++ DR+TG ++G+GF+ F P+ A Sbjct: 7 KLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVA 60 Score = 47.6 bits (108), Expect = 9e-06 Identities = 22/68 (32%), Positives = 33/68 (48%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 R +++VG L +V + YF QFG V++D +T +G+GFI + S A Sbjct: 106 RTRKIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEEAVEKV 165 Query: 488 TNKQIHTL 511 K H L Sbjct: 166 LLKTFHEL 173 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 59.3 bits (137), Expect = 3e-09 Identities = 24/62 (38%), Positives = 38/62 (61%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADAT 490 + +L++G L+W LR+ F+ FG V A+V+ DR TG S+G+GF+ F AA A Sbjct: 34 STKLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAI 93 Query: 491 NK 496 ++ Sbjct: 94 SE 95 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 59.3 bits (137), Expect = 3e-09 Identities = 24/62 (38%), Positives = 38/62 (61%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADAT 490 + +L++G L+W LR+ F+ FG V A+V+ DR TG S+G+GF+ F AA A Sbjct: 34 STKLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAI 93 Query: 491 NK 496 ++ Sbjct: 94 SE 95 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/57 (45%), Positives = 36/57 (63%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 R+YVGNL+W V L FS+ G V ARV++DR +G SKG+GF+ + S +A Sbjct: 205 RVYVGNLSWGVDDMALESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNA 261 Score = 50.0 bits (114), Expect = 2e-06 Identities = 22/60 (36%), Positives = 35/60 (58%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 +L+VGNL + V QL + F G V+ V++D+ TG S+G+GF+ +S S A + Sbjct: 92 KLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDKITGRSRGFGFVTMSSVSEVEAAAQQ 151 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 59.3 bits (137), Expect = 3e-09 Identities = 24/57 (42%), Positives = 36/57 (63%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +++VG LAW ++R YF QFG + A ++ D++TG SKGYGF+ F +A A Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRA 74 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 59.3 bits (137), Expect = 3e-09 Identities = 24/57 (42%), Positives = 36/57 (63%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +++VG LAW ++R YF QFG + A ++ D++TG SKGYGF+ F +A A Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRA 74 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 59.3 bits (137), Expect = 3e-09 Identities = 24/57 (42%), Positives = 36/57 (63%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +++VG LAW ++R YF QFG + A ++ D++TG SKGYGF+ F +A A Sbjct: 18 KVFVGGLAWETPTDEMRRYFDQFGEILEAVIITDKATGKSKGYGFVTFRDSDSATRA 74 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 58.0 bits (134), Expect = 6e-09 Identities = 27/65 (41%), Positives = 37/65 (56%) Frame = +2 Query: 293 MASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPS 472 MAS R +VG LAW R L F+Q+G V ++++ DR TG S+G+GF+ F Sbjct: 1 MASGDVEYRCFVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEK 60 Query: 473 AAADA 487 A DA Sbjct: 61 AMKDA 65 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 58.0 bits (134), Expect = 6e-09 Identities = 27/65 (41%), Positives = 37/65 (56%) Frame = +2 Query: 293 MASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPS 472 MAS R +VG LAW R L F+Q+G V ++++ DR TG S+G+GF+ F Sbjct: 1 MASGDVEYRCFVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEK 60 Query: 473 AAADA 487 A DA Sbjct: 61 AMKDA 65 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 57.6 bits (133), Expect = 8e-09 Identities = 21/56 (37%), Positives = 37/56 (66%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 + +L++G ++W +LR+YF FG V A ++ DR+TG ++G+GF+ F P+ A Sbjct: 5 SCKLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVA 60 Score = 51.6 bits (118), Expect = 5e-07 Identities = 22/69 (31%), Positives = 38/69 (55%) Frame = +2 Query: 305 ARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAAD 484 + + +++VG LA +V + ++YF+QFG + V++D T +G+GFI + S A Sbjct: 103 SNSKKIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDK 162 Query: 485 ATNKQIHTL 511 K H L Sbjct: 163 VLQKTFHEL 171 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 57.6 bits (133), Expect = 8e-09 Identities = 21/56 (37%), Positives = 37/56 (66%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 + +L++G ++W +LR+YF FG V A ++ DR+TG ++G+GF+ F P+ A Sbjct: 5 SCKLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVA 60 Score = 51.6 bits (118), Expect = 5e-07 Identities = 22/69 (31%), Positives = 38/69 (55%) Frame = +2 Query: 305 ARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAAD 484 + + +++VG LA +V + ++YF+QFG + V++D T +G+GFI + S A Sbjct: 103 SNSKKIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDK 162 Query: 485 ATNKQIHTL 511 K H L Sbjct: 163 VLQKTFHEL 171 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/57 (42%), Positives = 34/57 (59%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 R +VG LAW L+ FSQFG V ++++ DR +G S+G+GF+ F A DA Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDA 63 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/57 (42%), Positives = 34/57 (59%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 R +VG LAW L+ FSQFG V ++++ DR +G S+G+GF+ F A DA Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDA 63 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/57 (42%), Positives = 34/57 (59%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 R +VG LAW L+ FSQFG V ++++ DR +G S+G+GF+ F A DA Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDA 63 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 57.2 bits (132), Expect = 1e-08 Identities = 24/57 (42%), Positives = 34/57 (59%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 R +VG LAW L+ FSQFG V ++++ DR +G S+G+GF+ F A DA Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDA 63 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/50 (52%), Positives = 34/50 (68%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTS 466 +L+VGNL+WTV L F + G V ARVVFD TG S+GYGF+ ++S Sbjct: 178 KLFVGNLSWTVTSESLAGAFRECGDVVGARVVFDGDTGRSRGYGFVCYSS 227 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTS 466 +LY GNL + V L + F + V+++R TG S+G+ F+ ++ Sbjct: 86 KLYFGNLPYNVDSATLAQIIQDFANPELVEVLYNRDTGQSRGFAFVTMSN 135 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 56.8 bits (131), Expect = 1e-08 Identities = 21/51 (41%), Positives = 35/51 (68%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSP 469 +L++G ++W +LR+YFS +G V A ++ DR+TG ++G+GFI F P Sbjct: 7 KLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADP 57 Score = 52.0 bits (119), Expect = 4e-07 Identities = 22/68 (32%), Positives = 36/68 (52%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 R +++VG L ++ + + YF QFG + V++D +T +G+GFI F S A Sbjct: 108 RTKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRV 167 Query: 488 TNKQIHTL 511 +K H L Sbjct: 168 LHKTFHEL 175 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 56.8 bits (131), Expect = 1e-08 Identities = 21/51 (41%), Positives = 35/51 (68%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSP 469 +L++G ++W +LR+YFS +G V A ++ DR+TG ++G+GFI F P Sbjct: 7 KLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADP 57 Score = 52.0 bits (119), Expect = 4e-07 Identities = 22/68 (32%), Positives = 36/68 (52%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 R +++VG L ++ + + YF QFG + V++D +T +G+GFI F S A Sbjct: 108 RTKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRV 167 Query: 488 TNKQIHTL 511 +K H L Sbjct: 168 LHKTFHEL 175 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 56.8 bits (131), Expect = 1e-08 Identities = 21/51 (41%), Positives = 35/51 (68%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSP 469 +L++G ++W +LR+YFS +G V A ++ DR+TG ++G+GFI F P Sbjct: 7 KLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADP 57 Score = 52.0 bits (119), Expect = 4e-07 Identities = 22/68 (32%), Positives = 36/68 (52%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 R +++VG L ++ + + YF QFG + V++D +T +G+GFI F S A Sbjct: 108 RTKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRV 167 Query: 488 TNKQIHTL 511 +K H L Sbjct: 168 LHKTFHEL 175 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 56.8 bits (131), Expect = 1e-08 Identities = 26/51 (50%), Positives = 30/51 (58%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEF 460 R +++VGNL W LR YF QFG V A VV + G SKGYGFI F Sbjct: 10 RVTKIFVGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGRSKGYGFITF 60 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 56.8 bits (131), Expect = 1e-08 Identities = 25/64 (39%), Positives = 38/64 (59%) Frame = +2 Query: 314 ARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATN 493 +R++VG L+W V RQL F ++G + +++ R TG +G+GFI FT A DA Sbjct: 12 SRIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAI- 70 Query: 494 KQIH 505 K +H Sbjct: 71 KHMH 74 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 56.8 bits (131), Expect = 1e-08 Identities = 25/64 (39%), Positives = 38/64 (59%) Frame = +2 Query: 314 ARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATN 493 +R++VG L+W V RQL F ++G + +++ R TG +G+GFI FT A DA Sbjct: 12 SRIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAI- 70 Query: 494 KQIH 505 K +H Sbjct: 71 KHMH 74 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 56.8 bits (131), Expect = 1e-08 Identities = 23/57 (40%), Positives = 36/57 (63%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +++VG LAW ++++F QFG + A V+ D+++G SKGYGF+ F AA A Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSA 70 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 56.8 bits (131), Expect = 1e-08 Identities = 23/57 (40%), Positives = 36/57 (63%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +++VG LAW ++++F QFG + A V+ D+++G SKGYGF+ F AA A Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSA 70 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 56.8 bits (131), Expect = 1e-08 Identities = 23/57 (40%), Positives = 36/57 (63%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +++VG LAW ++++F QFG + A V+ D+++G SKGYGF+ F AA A Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSA 70 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 56.4 bits (130), Expect = 2e-08 Identities = 24/57 (42%), Positives = 36/57 (63%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 R ++G LAWT R LR+ F ++G + A+VV D+ +G S+G+GFI F A +A Sbjct: 8 RCFIGGLAWTTSDRGLRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEA 64 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 56.4 bits (130), Expect = 2e-08 Identities = 23/59 (38%), Positives = 38/59 (64%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +++L+VG L+W L++ F+ FG V A V+ DR TG S+G+GF+ F+ +A +A Sbjct: 34 SSKLFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNA 92 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 56.4 bits (130), Expect = 2e-08 Identities = 23/59 (38%), Positives = 38/59 (64%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +++L+VG L+W L++ F+ FG V A V+ DR TG S+G+GF+ F+ +A +A Sbjct: 34 SSKLFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNA 92 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 56.4 bits (130), Expect = 2e-08 Identities = 25/79 (31%), Positives = 48/79 (60%) Frame = +2 Query: 251 RSSLHLLEIVSL*VMASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTG 430 ++S H+ S+ +++++VG ++++ LRE FS++G V A+++ DR TG Sbjct: 13 QTSSHVTASSSMLQSIRCMSSSKIFVGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETG 72 Query: 431 LSKGYGFIEFTSPSAAADA 487 S+G+ F+ FTS A++A Sbjct: 73 RSRGFAFVTFTSTEEASNA 91 >At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 100 Score = 56.0 bits (129), Expect = 2e-08 Identities = 29/79 (36%), Positives = 40/79 (50%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 R ++YV L W L YF +FG + A+VV D +T SKG+GF+ F +A A Sbjct: 7 RETKIYVAGLPWITRTEGLISYFERFGEIVYAKVVCDGATQRSKGFGFVTFREVESATRA 66 Query: 488 TNKQIHTLKVST*VFNCKI 544 HT+ T NCK+ Sbjct: 67 CENPNHTIDGRT--VNCKL 83 >At1g71800.1 68414.m08298 cleavage stimulation factor, putative similar to cleavage stimulation factor 64 kilodalton subunit GB:AAD47839 GI:5713194 from [Drosophila melanogaster], SP|P33240 Cleavage stimulation factor, 64 kDa subunit {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 461 Score = 56.0 bits (129), Expect = 2e-08 Identities = 29/66 (43%), Positives = 38/66 (57%), Gaps = 1/66 (1%) Frame = +2 Query: 293 MASTARAAR-LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSP 469 MAS++ R ++VGN+ + QLRE + GPV S R+V DR TG KGYGF E+ Sbjct: 1 MASSSSQRRCVFVGNIPYDATEEQLREICGEVGPVVSFRLVTDRETGKPKGYGFCEYKDE 60 Query: 470 SAAADA 487 A A Sbjct: 61 ETALSA 66 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 54.8 bits (126), Expect = 6e-08 Identities = 31/76 (40%), Positives = 44/76 (57%), Gaps = 7/76 (9%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTS---PSAAADA 487 +LYVGNL + + QLR+ F FGPV+ ++ D TG KG+GFI+F AA A Sbjct: 266 KLYVGNLHFNMSELQLRQIFEAFGPVELVQLPLDPETGQCKGFGFIQFVQLEHSKAAQIA 325 Query: 488 TNKQI----HTLKVST 523 N ++ T+KVS+ Sbjct: 326 LNGKLEIAGRTIKVSS 341 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/35 (45%), Positives = 25/35 (71%) Frame = +2 Query: 356 RQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEF 460 R + E+FS+ G V+ R++ DR++ SKG G+IEF Sbjct: 182 RDVYEFFSKAGKVRDVRLIMDRNSRRSKGVGYIEF 216 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 54.8 bits (126), Expect = 6e-08 Identities = 21/68 (30%), Positives = 38/68 (55%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 + +++VG L T+ + R+YF +GPV +++D++T +G+GF+ F S A Sbjct: 108 KTKKIFVGGLPPTLTDEEFRQYFEVYGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSV 167 Query: 488 TNKQIHTL 511 +K H L Sbjct: 168 LHKTFHDL 175 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/65 (35%), Positives = 41/65 (63%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 +L+VG ++W +LRE+F+ +G V A V+ D+ TG +G+GF+ F+ PS D + Sbjct: 7 KLFVGGISWETDEDKLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPS-VLDRVLQ 65 Query: 497 QIHTL 511 + H++ Sbjct: 66 EKHSI 70 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 54.8 bits (126), Expect = 6e-08 Identities = 20/52 (38%), Positives = 34/52 (65%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPS 472 +L++G ++W LREYFS FG V V+ +++TG +G+GF+ F+ P+ Sbjct: 7 KLFIGGISWDTDENLLREYFSNFGEVLQVTVMREKATGRPRGFGFVAFSDPA 58 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/71 (29%), Positives = 37/71 (52%) Frame = +2 Query: 299 STARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 + R +++VG L + + R YF +GPV A ++ D++T +G+GF+ F S + Sbjct: 105 ANVRTKKIFVGGLPPALTSDEFRAYFETYGPVSDAVIMIDQTTQRPRGFGFVSFDSEDSV 164 Query: 479 ADATNKQIHTL 511 +K H L Sbjct: 165 DLVLHKTFHDL 175 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 54.4 bits (125), Expect = 8e-08 Identities = 25/59 (42%), Positives = 38/59 (64%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 +++ NL ++ H+ L E FS FGP+ S +V D S G SKGYGF+++ + AA A +K Sbjct: 135 IFIKNLDKSIDHKALHETFSAFGPILSCKVAVDPS-GQSKGYGFVQYDTDEAAQGAIDK 192 Score = 51.2 bits (117), Expect = 7e-07 Identities = 27/59 (45%), Positives = 36/59 (61%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 LYVG+L TV QL E F+Q G V S RV D +T S GYG++ + +P A+ A N+ Sbjct: 47 LYVGDLDATVTDSQLFEAFTQAGQVVSVRVCRDMTTRRSLGYGYVNYATPQDASRALNE 105 Score = 51.2 bits (117), Expect = 7e-07 Identities = 28/69 (40%), Positives = 43/69 (62%) Frame = +2 Query: 281 SL*VMASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEF 460 SL A ++ + LYV NL +V +LRE+F+ FG + S +V+ D S G+S+G GF+ F Sbjct: 316 SLKEAADKSQGSNLYVKNLDESVTDDKLREHFAPFGTITSCKVMRDPS-GVSRGSGFVAF 374 Query: 461 TSPSAAADA 487 ++P A A Sbjct: 375 STPEEATRA 383 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/58 (34%), Positives = 33/58 (56%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATN 493 +YV NL+ ++ +L + F +FG S ++ D G SKG+GF+ F + AA A + Sbjct: 226 VYVKNLSESLSDEELNKVFGEFGVTTSCVIMRD-GEGKSKGFGFVNFENSDDAARAVD 282 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 54.0 bits (124), Expect = 1e-07 Identities = 27/76 (35%), Positives = 39/76 (51%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 ++YVG L WT L +F +FG + VV DR T S+GYGF+ F +A A Sbjct: 14 KIYVGGLPWTTRKEGLINFFKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACKD 73 Query: 497 QIHTLKVST*VFNCKI 544 T++ + NCK+ Sbjct: 74 PNPTIEGR--ITNCKL 87 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 53.6 bits (123), Expect = 1e-07 Identities = 32/78 (41%), Positives = 47/78 (60%), Gaps = 4/78 (5%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADAT 490 A R+YVGNL+ T LRE FS +G V A V+ DR T S+G+GF+ ++S S A A Sbjct: 2 ATRVYVGNLSPTTTDDMLREAFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAV 61 Query: 491 N----KQIHTLKVST*VF 532 + K+++ +VS +F Sbjct: 62 SGMDGKELNGRRVSVKLF 79 >At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to SP|P19684 33 kDa ribonucleoprotein, chloroplast precursor {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 308 Score = 53.6 bits (123), Expect = 1e-07 Identities = 30/62 (48%), Positives = 35/62 (56%), Gaps = 2/62 (3%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFS--QFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADAT 490 +LYV NLAW LRE F+ F PV SARVVF G S GYGF+ F + A +A Sbjct: 195 KLYVSNLAWKARSTHLRELFTAADFNPV-SARVVFADPEGRSSGYGFVSFATREEAENAI 253 Query: 491 NK 496 K Sbjct: 254 TK 255 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 53.6 bits (123), Expect = 1e-07 Identities = 23/50 (46%), Positives = 33/50 (66%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTS 466 ++YVGNL W LR +FS+FG + S RV+ DR TG ++ + F+ FTS Sbjct: 213 KVYVGNLPWFTQPDGLRNHFSKFGTIVSTRVLHDRKTGRNRVFAFLSFTS 262 Score = 34.7 bits (76), Expect = 0.065 Identities = 20/57 (35%), Positives = 29/57 (50%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 R LYV N+ + QL + F FG V S V + TG S+G G++ S ++A Sbjct: 106 RPCELYVCNIPRSYDIAQLLDMFQPFGTVISVEVSRNPQTGESRGSGYVTMGSINSA 162 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 52.4 bits (120), Expect = 3e-07 Identities = 23/57 (40%), Positives = 34/57 (59%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +++V L W L E F Q+G ++ + VFD+ +G SKGYGFI + S S A +A Sbjct: 141 KIFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNA 197 Score = 35.9 bits (79), Expect = 0.028 Identities = 17/66 (25%), Positives = 34/66 (51%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 ++YV N+ + ++L +FS+FG ++ + D+ TG KG+ + S +A A + Sbjct: 246 KIYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEE 305 Query: 497 QIHTLK 514 T + Sbjct: 306 PHKTFE 311 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 52.4 bits (120), Expect = 3e-07 Identities = 23/57 (40%), Positives = 34/57 (59%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +++V L W L E F Q+G ++ + VFD+ +G SKGYGFI + S S A +A Sbjct: 141 KIFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNA 197 Score = 35.9 bits (79), Expect = 0.028 Identities = 17/66 (25%), Positives = 34/66 (51%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 ++YV N+ + ++L +FS+FG ++ + D+ TG KG+ + S +A A + Sbjct: 246 KIYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEE 305 Query: 497 QIHTLK 514 T + Sbjct: 306 PHKTFE 311 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 52.4 bits (120), Expect = 3e-07 Identities = 23/57 (40%), Positives = 34/57 (59%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +++V L W L E F Q+G ++ + VFD+ +G SKGYGFI + S S A +A Sbjct: 141 KIFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNA 197 Score = 35.9 bits (79), Expect = 0.028 Identities = 17/66 (25%), Positives = 34/66 (51%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 ++YV N+ + ++L +FS+FG ++ + D+ TG KG+ + S +A A + Sbjct: 246 KIYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEE 305 Query: 497 QIHTLK 514 T + Sbjct: 306 PHKTFE 311 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 52.4 bits (120), Expect = 3e-07 Identities = 27/65 (41%), Positives = 40/65 (61%) Frame = +2 Query: 302 TARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAA 481 T + LYV NL +V + +L E FS+FG + S +V+ S G+SKG GF+EF++ A+ Sbjct: 219 TRKGMNLYVKNLDDSVDNTKLEELFSEFGTITSCKVMV-HSNGISKGVGFVEFSTSEEAS 277 Query: 482 DATNK 496 A K Sbjct: 278 KAMLK 282 Score = 48.4 bits (110), Expect = 5e-06 Identities = 27/64 (42%), Positives = 39/64 (60%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNKQ 499 ++V NL ++ ++QL + FS FG V S +V D S G+SKGYGF++F S + A N Sbjct: 33 VFVKNLDESIDNKQLCDMFSAFGKVLSCKVARDAS-GVSKGYGFVQFYSDLSVYTACNFH 91 Query: 500 IHTL 511 TL Sbjct: 92 NGTL 95 Score = 42.3 bits (95), Expect = 3e-04 Identities = 26/83 (31%), Positives = 36/83 (43%) Frame = +2 Query: 248 RRSSLHLLEIVSL*VMASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRST 427 R +H+ VS + +YV NL T L+ F +FG + SA VV Sbjct: 97 RNQHIHVCPFVSRGQWDKSRVFTNVYVKNLVETATDADLKRLFGEFGEITSA-VVMKDGE 155 Query: 428 GLSKGYGFIEFTSPSAAADATNK 496 G S+ +GF+ F AA A K Sbjct: 156 GKSRRFGFVNFEKAEAAVTAIEK 178 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 52.0 bits (119), Expect = 4e-07 Identities = 29/84 (34%), Positives = 49/84 (58%) Frame = +2 Query: 245 DRRSSLHLLEIVSL*VMASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRS 424 +R + L + +L A +++ LYV NL ++ +L+E FS FG V S++V+ D + Sbjct: 109 ERETELRVRYEQNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSSKVMRDPN 168 Query: 425 TGLSKGYGFIEFTSPSAAADATNK 496 G SKG GF+ F +P A +A ++ Sbjct: 169 -GTSKGSGFVAFATPEEATEAMSQ 191 Score = 41.9 bits (94), Expect = 4e-04 Identities = 23/64 (35%), Positives = 34/64 (53%) Frame = +2 Query: 296 ASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSA 475 A+ + +YV NLA + L+ F ++G + SA VV G SKG+GF+ F + Sbjct: 23 ANKTKFTNVYVKNLAESTTDDDLKNAFGEYGKITSA-VVMKDGEGKSKGFGFVNFENADD 81 Query: 476 AADA 487 AA A Sbjct: 82 AARA 85 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 51.6 bits (118), Expect = 5e-07 Identities = 22/69 (31%), Positives = 38/69 (55%) Frame = +2 Query: 305 ARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAAD 484 + + +++VG LA +V + ++YF+QFG + V++D T +G+GFI + S A Sbjct: 30 SNSKKIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDK 89 Query: 485 ATNKQIHTL 511 K H L Sbjct: 90 VLQKTFHEL 98 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 51.6 bits (118), Expect = 5e-07 Identities = 26/67 (38%), Positives = 41/67 (61%) Frame = +2 Query: 305 ARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAAD 484 A+ + +YV N+ V +LR++FSQ G + S +++ D G SKG+GF+ F++P A D Sbjct: 301 AKVSNIYVKNVNVAVTEEELRKHFSQCGTITSTKLMCDEK-GKSKGFGFVCFSTPEEAID 359 Query: 485 ATNKQIH 505 A K H Sbjct: 360 AV-KTFH 365 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 LY+ NL V LRE F++FG + S + D + L +GY F+ F +P A A Sbjct: 203 LYMKNLDADVSEDLLREKFAEFGKIVSLAIAKDENR-LCRGYAFVNFDNPEDARRA 257 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/80 (27%), Positives = 41/80 (51%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNKQ 499 ++V NL +V + L++ F +FG + S +V G S+GYGF++F AA A Sbjct: 114 VFVKNLPESVTNAVLQDMFKKFGNIVSCKVA-TLEDGKSRGYGFVQFEQEDAAHAAIQTL 172 Query: 500 IHTLKVST*VFNCKIIRYSE 559 T+ ++ K ++ ++ Sbjct: 173 NSTIVADKEIYVGKFMKKTD 192 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 51.6 bits (118), Expect = 5e-07 Identities = 20/60 (33%), Positives = 34/60 (56%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 R +VG LAW + + F++FG V ++++ DR TG SKG+ F+ F + A ++ Sbjct: 45 RCFVGGLAWATDEQSIERCFNEFGEVFDSKIIIDRETGRSKGFRFVTFKDEDSMRTAIDR 104 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 50.8 bits (116), Expect = 9e-07 Identities = 22/63 (34%), Positives = 37/63 (58%) Frame = +2 Query: 299 STARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 ++ RLYVGNL +T+ +L + F + G V ++V+D+ T S+G+GF+ S A Sbjct: 111 ASGEEGRLYVGNLPYTITSSELSQIFGEAGTVVDVQIVYDKVTDRSRGFGFVTMGSIEEA 170 Query: 479 ADA 487 +A Sbjct: 171 KEA 173 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/50 (40%), Positives = 33/50 (66%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTS 466 ++Y GNL W + + L++ F V A+V+++R+TG S+G+GFI F S Sbjct: 220 KVYAGNLGWNLTSQGLKDAFGDQPGVLGAKVIYERNTGRSRGFGFISFES 269 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 50.8 bits (116), Expect = 9e-07 Identities = 27/61 (44%), Positives = 35/61 (57%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADAT 490 A RLYVGNL + LR+ F FG V+ +V D TGL KG+GF++F A +A Sbjct: 284 ARRLYVGNLHINMSEDDLRKVFESFGSVELVQVPRD-ETGLCKGFGFVQFARLEDARNAL 342 Query: 491 N 493 N Sbjct: 343 N 343 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/47 (31%), Positives = 28/47 (59%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEF 460 ++ +A R + E+FS+ G V+ R++ DR + S+G G++EF Sbjct: 184 VFAYQIALRATERDVYEFFSRAGKVRDVRIIMDRISRRSRGIGYVEF 230 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 50.4 bits (115), Expect = 1e-06 Identities = 23/59 (38%), Positives = 35/59 (59%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 + +LY+G L+ L++ FS F V ARV+ ++ TG S+GYGF+ F S +A A Sbjct: 30 STKLYIGGLSPGTDEHSLKDAFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSA 88 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 50.4 bits (115), Expect = 1e-06 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 6/76 (7%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSA---A 478 +A LY+G + ++ +FSQFG V+ RV ++ TG SK +GFI+F P A Sbjct: 58 KATVLYIGRIPHGFYETEIEAFFSQFGTVKRVRVARNKKTGKSKHFGFIQFEDPEVAEIA 117 Query: 479 ADATNKQI---HTLKV 517 A A N + H LKV Sbjct: 118 AGAMNDYLLMEHMLKV 133 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 50.4 bits (115), Expect = 1e-06 Identities = 23/64 (35%), Positives = 40/64 (62%) Frame = +2 Query: 314 ARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATN 493 +R++VG L+ V R L FS+FG + +++ +R TG S+G+GFI F + A D + Sbjct: 7 SRIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITF-ADRRAMDESI 65 Query: 494 KQIH 505 +++H Sbjct: 66 REMH 69 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 50.4 bits (115), Expect = 1e-06 Identities = 27/59 (45%), Positives = 38/59 (64%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 LYV NL TV +LRE F++FG + S +V+ D S G SKG GF+ F++ S A+ N+ Sbjct: 330 LYVKNLDDTVTDEKLRELFAEFGTITSCKVMRDPS-GTSKGSGFVAFSAASEASRVLNE 387 Score = 46.4 bits (105), Expect = 2e-05 Identities = 23/59 (38%), Positives = 34/59 (57%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 LYVG+L + V QL +YF++ V S RV D +T S GYG++ +++ A A K Sbjct: 48 LYVGDLDFNVTDSQLYDYFTEVCQVVSVRVCRDAATNTSLGYGYVNYSNTDDAEKAMQK 106 Score = 44.4 bits (100), Expect = 8e-05 Identities = 24/67 (35%), Positives = 37/67 (55%) Frame = +2 Query: 296 ASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSA 475 A + L+V NL +V ++ L E FS G + S +V D G S+GYGF++F + + Sbjct: 128 ARRSGVGNLFVKNLDKSVDNKTLHEAFSGCGTIVSCKVATDHM-GQSRGYGFVQFDTEDS 186 Query: 476 AADATNK 496 A +A K Sbjct: 187 AKNAIEK 193 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/64 (34%), Positives = 34/64 (53%) Frame = +2 Query: 296 ASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSA 475 A + +YV NL+ +L+ F Q+G + SA V+ D G S+ +GF+ F +P Sbjct: 219 ADKMKFTNVYVKNLSEATTDDELKTTFGQYGSISSAVVMRD-GDGKSRCFGFVNFENPED 277 Query: 476 AADA 487 AA A Sbjct: 278 AARA 281 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 50.0 bits (114), Expect = 2e-06 Identities = 24/66 (36%), Positives = 38/66 (57%) Frame = +2 Query: 290 VMASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSP 469 V A L++ N+ G ++L F FG V SA+V D++TG+SK +GF+ + S Sbjct: 341 VQTEGPEGANLFIYNIPREFGDQELAAAFQSFGIVLSAKVFVDKATGVSKCFGFVSYDSQ 400 Query: 470 SAAADA 487 +AA +A Sbjct: 401 AAAQNA 406 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/61 (26%), Positives = 27/61 (44%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADAT 490 + +L+VG + + QL F +F V ++ D+ T S+G F+ S A Sbjct: 17 SVKLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLV 76 Query: 491 N 493 N Sbjct: 77 N 77 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 50.0 bits (114), Expect = 2e-06 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 1/78 (1%) Frame = +2 Query: 257 SLHLLEIVSL*VM-ASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGL 433 S LL SL V ST + RL+V L+ + +L++ F+ FG + ARV+ DR +G Sbjct: 14 SSSLLSSPSLCVRRCSTLTSPRLFVSGLSRLTTNEKLQDAFASFGQLVDARVITDRDSGR 73 Query: 434 SKGYGFIEFTSPSAAADA 487 SKG+GF+ + + A A Sbjct: 74 SKGFGFVTYATIEDAEKA 91 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 50.0 bits (114), Expect = 2e-06 Identities = 27/65 (41%), Positives = 38/65 (58%) Frame = +2 Query: 302 TARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAA 481 T R +YV NL +G +LR+ F +FG + SA V+ D+S G S+ +GF+ F AAA Sbjct: 225 TPRFTNVYVKNLPKEIGEDELRKTFGKFGVISSAVVMRDQS-GNSRCFGFVNFECTEAAA 283 Query: 482 DATNK 496 A K Sbjct: 284 SAVEK 288 Score = 48.4 bits (110), Expect = 5e-06 Identities = 29/80 (36%), Positives = 42/80 (52%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNKQ 499 +++ NL ++ ++ L E FS FG + S +V D TG SKGYGF++F +A A +K Sbjct: 138 IFIKNLDASIDNKALFETFSSFGTILSCKVAMD-VTGRSKGYGFVQFEKEESAQAAIDKL 196 Query: 500 IHTLKVST*VFNCKIIRYSE 559 L VF IR E Sbjct: 197 NGMLMNDKQVFVGHFIRRQE 216 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/64 (34%), Positives = 43/64 (67%) Frame = +2 Query: 305 ARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAAD 484 ++ A LY+ NL +V +L+E FS++G V S++V+ + G+S+G+GF+ +++P A Sbjct: 329 SQGANLYLKNLDDSVDDEKLKEMFSEYGNVTSSKVMLN-PQGMSRGFGFVAYSNPEEALR 387 Query: 485 ATNK 496 A ++ Sbjct: 388 ALSE 391 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/60 (40%), Positives = 37/60 (61%) Frame = +2 Query: 314 ARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATN 493 A L++ N+ ++L F FG V SA+V D++TG+SK +GFI + S +AA +A N Sbjct: 339 ANLFIYNIPREFEDQELAATFQPFGKVLSAKVFVDKATGISKCFGFISYDSQAAAQNAIN 398 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/57 (28%), Positives = 31/57 (54%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +L+VG L V +++ FS++G ++ +++ S SKG F+++ S A A Sbjct: 110 KLFVGMLPKNVSETEVQSLFSEYGTIKDLQIL-RGSLQTSKGCLFLKYESKEQAVAA 165 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/60 (40%), Positives = 37/60 (61%) Frame = +2 Query: 314 ARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATN 493 A L++ N+ ++L F FG V SA+V D++TG+SK +GFI + S +AA +A N Sbjct: 330 ANLFIYNIPREFEDQELAATFQPFGKVLSAKVFVDKATGISKCFGFISYDSQAAAQNAIN 389 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/57 (28%), Positives = 31/57 (54%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +L+VG L V +++ FS++G ++ +++ S SKG F+++ S A A Sbjct: 101 KLFVGMLPKNVSETEVQSLFSEYGTIKDLQIL-RGSLQTSKGCLFLKYESKEQAVAA 156 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/59 (38%), Positives = 36/59 (61%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 A++L++G L++ + L E FS+ G V A++V DR + SKG+GF+ F S A A Sbjct: 33 ASKLFIGGLSFCTTEQGLSEAFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKA 91 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 49.2 bits (112), Expect = 3e-06 Identities = 25/76 (32%), Positives = 41/76 (53%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 +++V L W L + F Q+G ++ + V D+ +G SKGYGFI F S S A +A + Sbjct: 129 KIFVHGLGWDTKADSLIDAFKQYGEIEDCKCVVDKVSGQSKGYGFILFKSRSGARNALKQ 188 Query: 497 QIHTLKVST*VFNCKI 544 K+ T + C++ Sbjct: 189 P--QKKIGTRMTACQL 202 Score = 41.9 bits (94), Expect = 4e-04 Identities = 18/66 (27%), Positives = 37/66 (56%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 ++YV N++ + ++L E+FS+FG ++ + D++TG KG+ + S +A A + Sbjct: 228 KIYVSNVSADIDPQKLLEFFSRFGEIEEGPLGLDKATGRPKGFALFVYRSLESAKKALEE 287 Query: 497 QIHTLK 514 T + Sbjct: 288 PHKTFE 293 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 48.8 bits (111), Expect = 4e-06 Identities = 21/57 (36%), Positives = 35/57 (61%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +L V + W + L++Y S+FG ++ V+ DRSTG S+G+G++ F S A +A Sbjct: 4 KLVVLGIPWDIDSDGLKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNA 60 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/65 (29%), Positives = 34/65 (52%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 +++VG L LR+YF +FG +Q A + D +G+GF+ F + + AD + Sbjct: 241 KIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKDPKRSGHRGFGFVTF-AENGVADRVAR 299 Query: 497 QIHTL 511 + H + Sbjct: 300 RSHEI 304 >At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 48.8 bits (111), Expect = 4e-06 Identities = 20/60 (33%), Positives = 34/60 (56%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 + +++VG LAW + ++F ++G + A ++ D+ T SKGYGF+ F AA A Sbjct: 15 KLTKVFVGGLAWDTHKEAMYDHFIKYGDILEAVIISDKLTRRSKGYGFVTFKDAKAATRA 74 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/57 (38%), Positives = 39/57 (68%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 + + LY+ NL +V +L+E FS++G V S +V+ + S GLS+G+GF+ +++P A Sbjct: 326 QGSNLYLKNLDDSVNDEKLKEMFSEYGNVTSCKVMMN-SQGLSRGFGFVAYSNPEEA 381 Score = 47.2 bits (107), Expect = 1e-05 Identities = 24/59 (40%), Positives = 37/59 (62%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 +YV NL + +L++ F ++G + SA V+ D+S G S+ +GF+ F SP AAA A K Sbjct: 227 VYVKNLPKEITDDELKKTFGKYGDISSAVVMKDQS-GNSRSFGFVNFVSPEAAAVAVEK 284 Score = 45.2 bits (102), Expect = 5e-05 Identities = 22/59 (37%), Positives = 34/59 (57%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 +++ NL ++ ++ L E FS FG + S +V D G SKGYGF++F A A +K Sbjct: 134 VFIKNLDASIDNKALYETFSSFGTILSCKVAMD-VVGRSKGYGFVQFEKEETAQAAIDK 191 Score = 39.5 bits (88), Expect = 0.002 Identities = 22/56 (39%), Positives = 31/56 (55%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 LYVG+L +V L + F+Q PV + RV D T S GY ++ F +P A+ A Sbjct: 47 LYVGDLDPSVNESHLLDLFNQVAPVHNLRVCRD-LTHRSLGYAYVNFANPEDASRA 101 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/52 (42%), Positives = 30/52 (57%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPS 472 R++VG L + Q+RE FGP++ +V DR TG SKGY F + PS Sbjct: 376 RIFVGGLPYYFTEVQIRELLESFGPLRGFNLVKDRETGNSKGYAFCVYQDPS 427 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/58 (37%), Positives = 36/58 (62%) Frame = +2 Query: 314 ARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 ++++VG L+ + L+E F FG + A VV DR +GLS+G+GF+ + S A +A Sbjct: 36 SKIFVGGLSPSTDVELLKEAFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIEVANNA 93 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/72 (30%), Positives = 40/72 (55%) Frame = +2 Query: 296 ASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSA 475 +S + +L+VG ++W YF +FG V + ++ DR TG +G+GF+ F + SA Sbjct: 60 SSMSSPGKLFVGGVSWETTAETFANYFGKFGEVVDSVIMTDRITGNPRGFGFVTF-ADSA 118 Query: 476 AADATNKQIHTL 511 A+ ++ H + Sbjct: 119 VAEKVLEEDHVI 130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/72 (26%), Positives = 41/72 (56%), Gaps = 1/72 (1%) Frame = +2 Query: 299 STARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEF-TSPSA 475 + ++ +++VG L + +L+ YF +G + ++++D TG S+G+GF+ F T S Sbjct: 152 AVSKTRKIFVGGLPPLLEEDELKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSV 211 Query: 476 AADATNKQIHTL 511 ++ ++H L Sbjct: 212 DRLFSDGKVHEL 223 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 48.0 bits (109), Expect = 7e-06 Identities = 23/53 (43%), Positives = 34/53 (64%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 L++G+L + V L FSQ G + S +V+ ++ TG +GYGFIEF S +AA Sbjct: 26 LWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAA 78 Score = 44.8 bits (101), Expect = 6e-05 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFS-QFGPVQSARVVFDRSTGLSKGYGFIEFTSPS 472 ++VG+LA V L+E F + V+ A+VV D STG SKGYGF++F S Sbjct: 118 IFVGDLAPDVTDYLLQETFRVHYSSVRGAKVVTDPSTGRSKGYGFVKFAEES 169 Score = 31.5 bits (68), Expect = 0.61 Identities = 18/66 (27%), Positives = 32/66 (48%) Frame = +2 Query: 299 STARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 S + V NL V +L++ FSQ G V ++ +KGYG+++F + +A Sbjct: 232 SDVTCTTISVANLDQNVTEEELKKAFSQLGEVIYVKIP------ATKGYGYVQFKTRPSA 285 Query: 479 ADATNK 496 +A + Sbjct: 286 EEAVQR 291 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 48.0 bits (109), Expect = 7e-06 Identities = 22/57 (38%), Positives = 32/57 (56%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 RL+V NL +T +L E+FS FG + +V D+ T S+G +I + P AA A Sbjct: 262 RLFVRNLPYTATEEELMEHFSTFGKISEVHLVLDKETKRSRGIAYILYLIPECAARA 318 Score = 43.6 bits (98), Expect = 1e-04 Identities = 21/57 (36%), Positives = 35/57 (61%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +L+V N+A+ R+LR+ FS FG ++S R+ ++ G GY F+EF + A +A Sbjct: 670 KLHVKNIAFEATKRELRQLFSPFGQIKSMRLP-KKNIGQYAGYAFVEFVTKQEALNA 725 Score = 29.1 bits (62), Expect = 3.3 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 5/58 (8%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQF---GPVQSARVVFDRSTG--LSKGYGFIEFTSPSAA 478 L V NL++ L+++F++ G + S ++ + LS GYGF+EF S A Sbjct: 571 LNVKNLSFKTTDEGLKKHFTKLVKQGKILSVTIIKHKKNEKYLSSGYGFVEFDSVETA 628 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 48.0 bits (109), Expect = 7e-06 Identities = 24/56 (42%), Positives = 32/56 (57%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 L V NL LR+ F QFGPV+ + D TG +G+GF++F P+ AADA Sbjct: 38 LLVRNLRHDCRQEDLRKSFEQFGPVKDIYLPRDYYTGDPRGFGFVQFMDPADAADA 93 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 47.6 bits (108), Expect = 9e-06 Identities = 23/60 (38%), Positives = 35/60 (58%) Frame = +2 Query: 299 STARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 S + L++G+L + + F+Q G SA+V+ ++ TG S+GYGFIEF S S A Sbjct: 55 SASDVKSLWIGDLQQWMDENYIMSVFAQSGEATSAKVIRNKLTGQSEGYGFIEFVSHSVA 114 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/48 (47%), Positives = 32/48 (66%), Gaps = 1/48 (2%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQ-FGPVQSARVVFDRSTGLSKGYGFIEF 460 ++VG+LA V L + F +G V+ A+VV DR+TG SKGYGF+ F Sbjct: 156 IFVGDLAPEVTDYMLSDTFKNVYGSVKGAKVVLDRTTGRSKGYGFVRF 203 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 47.2 bits (107), Expect = 1e-05 Identities = 24/56 (42%), Positives = 32/56 (57%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 LY+G L + L FS FG + A+V+ DR TGLSKGYGF+++ A A Sbjct: 482 LYIGFLPPMLEDDGLINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKYADVQMANTA 537 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 47.2 bits (107), Expect = 1e-05 Identities = 24/56 (42%), Positives = 32/56 (57%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 LY+G L + L FS FG + A+V+ DR TGLSKGYGF+++ A A Sbjct: 482 LYIGFLPPMLEDDGLINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKYADVQMANTA 537 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 46.8 bits (106), Expect = 2e-05 Identities = 17/53 (32%), Positives = 35/53 (66%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTS 466 + +++VG + +V + +E+F QFG ++ +++ D STG S+G+GF+ + S Sbjct: 128 KTKKIFVGGIPSSVDDDEFKEFFMQFGELKEHQIMRDHSTGRSRGFGFVTYES 180 Score = 40.3 bits (90), Expect = 0.001 Identities = 15/54 (27%), Positives = 31/54 (57%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPS 472 A +++VG LA + ++F ++G + + ++ DR TG +G+GF+ + S Sbjct: 41 AGKIFVGGLARETTSAEFLKHFGKYGEITDSVIMKDRKTGQPRGFGFVTYADSS 94 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/65 (35%), Positives = 37/65 (56%) Frame = +2 Query: 302 TARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAA 481 T+ ++VG+L+ V L + FS F ARV++D+ TG S+G+GF+ F + A Sbjct: 140 TSSHFNIFVGDLSPEVTDATLYQSFSVFSSCSDARVMWDQKTGRSRGFGFVSFRNQQDAQ 199 Query: 482 DATNK 496 A N+ Sbjct: 200 TAINE 204 Score = 33.9 bits (74), Expect = 0.11 Identities = 22/62 (35%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Frame = +2 Query: 299 STARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVV-FDRSTGLSKGYGFIEFTSPSA 475 ST R+ +YVGN+ V L+E F+ GPV+S++++ D+S+ YGF+ + + Sbjct: 56 STCRS--VYVGNIHTQVTEPLLQEIFTSTGPVESSKLIRKDKSS-----YGFVHYFDRRS 108 Query: 476 AA 481 AA Sbjct: 109 AA 110 Score = 32.7 bits (71), Expect = 0.26 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEF-TSPSAA 478 +YVGNLA V L YF G A V+ + KG+GF+ + T P AA Sbjct: 267 VYVGNLAPEVTQLDLHRYFHALG----AGVIEEVRVQRDKGFGFVRYNTHPEAA 316 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 46.8 bits (106), Expect = 2e-05 Identities = 18/59 (30%), Positives = 29/59 (49%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 ++V W L+ F +G ++ VV D+ TG KGYGF+ F + A +A + Sbjct: 410 IFVRGFGWDTTQENLKTAFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALKR 468 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/65 (35%), Positives = 37/65 (56%) Frame = +2 Query: 302 TARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAA 481 T+ ++VG+L+ V L + FS F ARV++D+ TG S+G+GF+ F + A Sbjct: 144 TSSHFNIFVGDLSPEVTDAALFDSFSAFNSCSDARVMWDQKTGRSRGFGFVSFRNQQDAQ 203 Query: 482 DATNK 496 A N+ Sbjct: 204 TAINE 208 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVV-FDRSTGLSKGYGFIEFTSPSAAADA 487 +Y GN+ V L+E F+ GP++S +++ D+S+ YGF+ + A+ A Sbjct: 65 VYAGNIHTQVTEILLQEIFASTGPIESCKLIRKDKSS-----YGFVHYFDRRCASMA 116 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 46.8 bits (106), Expect = 2e-05 Identities = 24/48 (50%), Positives = 33/48 (68%), Gaps = 1/48 (2%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGP-VQSARVVFDRSTGLSKGYGFIEF 460 ++VG+LA V L E FS+ P V++A+VV D +TG SKGYGF+ F Sbjct: 201 IFVGDLAPDVSDALLHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRF 248 Score = 33.5 bits (73), Expect = 0.15 Identities = 18/59 (30%), Positives = 32/59 (54%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 ++VG L +V L++ FS+FG + S ++ + KG GF++F + A +A K Sbjct: 308 IFVGGLDSSVTDEDLKQPFSEFGEIVSVKI------PVGKGCGFVQFVNRPNAEEALEK 360 Score = 31.1 bits (67), Expect = 0.81 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFS--QFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 ++VG+L + L F+ + + S +V+ ++ G S+GYGF+EF S A Sbjct: 105 IWVGDLQNWMDEAYLNSAFTSAEEREIVSLKVIRNKHNGSSEGYGFVEFESHDVA 159 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 46.4 bits (105), Expect = 2e-05 Identities = 23/59 (38%), Positives = 34/59 (57%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +A+L+V L+ + LR+ FS FG ++ AR++ D T KG+GFI F S A A Sbjct: 6 SAQLFVSRLSAYTTDQSLRQLFSPFGQIKEARLIRDSETQRPKGFGFITFDSEDDARKA 64 >At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a) almost identical to SC35-like splicing factor SCL30a GI:9843661 from [Arabidopsis thaliana]; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 46.4 bits (105), Expect = 2e-05 Identities = 24/59 (40%), Positives = 33/59 (55%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 L V NL LR F QFGPV+ + D TG +G+GFI+F P+ AA+A ++ Sbjct: 39 LLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYTGDPRGFGFIQFMDPADAAEAKHQ 97 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/52 (40%), Positives = 31/52 (59%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTS 466 + L+V L+ LR F+QFG V A+VV DR +G SKG+GF+ + + Sbjct: 55 STNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYAT 106 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 46.0 bits (104), Expect = 3e-05 Identities = 24/52 (46%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQ-FGPVQSARVVFDRSTGLSKGYGFIEFTSPS 472 ++VG+LA V L E F + V+ A+VV DR+TG SKGYGF+ F S Sbjct: 175 VFVGDLAPDVTDHMLTETFKAVYSSVKGAKVVNDRTTGRSKGYGFVRFADES 226 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/60 (31%), Positives = 31/60 (51%) Frame = +2 Query: 299 STARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 S L++G+L + L F G +A+V+ ++ G S+GYGFIEF + + A Sbjct: 75 SAGEIRSLWIGDLQPWMDENYLMNVFGLTGEATAAKVIRNKQNGYSEGYGFIEFVNHATA 134 >At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing protein similar to ssRNA-binding protein [Dictyostelium discoideum] GI:1546894; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 46.0 bits (104), Expect = 3e-05 Identities = 22/57 (38%), Positives = 34/57 (59%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 RL+ G+L V L + F++F A+V+ D+ TG +KGYGF+ F +P+ A A Sbjct: 138 RLFCGDLGNEVNDDVLSKAFARFPTFNMAKVIRDKRTGKTKGYGFVSFLNPADLAAA 194 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/56 (33%), Positives = 29/56 (51%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 ++V L W H L+ F +G + VV D+ TG +KG+GF+ F + A A Sbjct: 165 IFVRGLGWDTTHENLKAAFEVYGEITECSVVMDKDTGRAKGFGFVLFKTRKGARAA 220 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 46.0 bits (104), Expect = 3e-05 Identities = 23/48 (47%), Positives = 33/48 (68%), Gaps = 1/48 (2%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGP-VQSARVVFDRSTGLSKGYGFIEF 460 ++VG+L+ V L E FS+ P V++A+VV D +TG SKGYGF+ F Sbjct: 199 IFVGDLSPDVSDNLLHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRF 246 Score = 34.7 bits (76), Expect = 0.065 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGP--VQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 ++VG+L + L F+ + S +V+ +++ GLS+GYGF+EF S A Sbjct: 103 IWVGDLHHWMDEAYLNSSFASGDEREIVSVKVIRNKNNGLSEGYGFVEFESHDVA 157 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 46.0 bits (104), Expect = 3e-05 Identities = 23/48 (47%), Positives = 33/48 (68%), Gaps = 1/48 (2%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGP-VQSARVVFDRSTGLSKGYGFIEF 460 ++VG+L+ V L E FS+ P V++A+VV D +TG SKGYGF+ F Sbjct: 199 IFVGDLSPDVSDNLLHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRF 246 Score = 34.7 bits (76), Expect = 0.065 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGP--VQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 ++VG+L + L F+ + S +V+ +++ GLS+GYGF+EF S A Sbjct: 103 IWVGDLHHWMDEAYLNSSFASGDEREIVSVKVIRNKNNGLSEGYGFVEFESHDVA 157 Score = 32.3 bits (70), Expect = 0.35 Identities = 17/59 (28%), Positives = 32/59 (54%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 ++VG L +V L++ F++FG + S ++ + KG GF++F + A +A K Sbjct: 306 IFVGGLDSSVTDEDLKQPFNEFGEIVSVKI------PVGKGCGFVQFVNRPNAEEALEK 358 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/77 (27%), Positives = 39/77 (50%) Frame = +2 Query: 314 ARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATN 493 + +++G L VG LR+ + G + R++ DR +G SKGY F+ F + A A Sbjct: 116 SEVFIGGLPRDVGEEDLRDLCEEIGEIFEVRLMKDRDSGDSKGYAFVAFKTKDVAQKAI- 174 Query: 494 KQIHTLKVST*VFNCKI 544 +++H+ + C + Sbjct: 175 EELHSKEFKGKTIRCSL 191 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 45.2 bits (102), Expect = 5e-05 Identities = 22/55 (40%), Positives = 33/55 (60%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAAD 484 L+VG+L + L FS G V S +V+ ++ T S+GYGF+EF S +AA + Sbjct: 110 LWVGDLLHWMDETYLHSCFSHTGEVSSVKVIRNKLTSQSEGYGFVEFLSRAAAEE 164 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/48 (50%), Positives = 32/48 (66%), Gaps = 1/48 (2%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGP-VQSARVVFDRSTGLSKGYGFIEF 460 ++VG+L+ V L E FS P V+SA+VV D +TG SKGYGF+ F Sbjct: 204 VFVGDLSPDVTDVLLHETFSDRYPSVKSAKVVIDSNTGRSKGYGFVRF 251 Score = 35.9 bits (79), Expect = 0.028 Identities = 21/58 (36%), Positives = 31/58 (53%) Frame = +2 Query: 314 ARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 A ++VG + V LR+ FSQFG V S ++ + KG GF++F +A DA Sbjct: 321 ATIFVGGIDPDVIDEDLRQPFSQFGEVVSVKI------PVGKGCGFVQFADRKSAEDA 372 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/48 (41%), Positives = 29/48 (60%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEF 460 +L++ LA LR FS +G ++ A V+ D+ TG SKGYGF+ F Sbjct: 76 KLFIRGLAADTTTEGLRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTF 123 Score = 35.5 bits (78), Expect = 0.037 Identities = 18/76 (23%), Positives = 36/76 (47%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 ++YV N+ + + +L +F +G V+ + FD+ TG S+G+ + + A A Sbjct: 168 KIYVANVPFDMPADRLLNHFMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALAD 227 Query: 497 QIHTLKVST*VFNCKI 544 + + NCK+ Sbjct: 228 PVKVIDGKH--LNCKL 241 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/48 (41%), Positives = 29/48 (60%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEF 460 +L++ LA LR FS +G ++ A V+ D+ TG SKGYGF+ F Sbjct: 76 KLFIRGLAADTTTEGLRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTF 123 Score = 35.5 bits (78), Expect = 0.037 Identities = 18/76 (23%), Positives = 36/76 (47%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 ++YV N+ + + +L +F +G V+ + FD+ TG S+G+ + + A A Sbjct: 168 KIYVANVPFDMPADRLLNHFMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALAD 227 Query: 497 QIHTLKVST*VFNCKI 544 + + NCK+ Sbjct: 228 PVKVIDGKH--LNCKL 241 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/63 (28%), Positives = 37/63 (58%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 + +++VG + TV +L+++F+++G V +V+ D T S+G+GF+ F S + Sbjct: 107 KTKKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDEL 166 Query: 488 TNK 496 +K Sbjct: 167 LSK 169 Score = 41.5 bits (93), Expect = 6e-04 Identities = 18/69 (26%), Positives = 35/69 (50%) Frame = +2 Query: 305 ARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAAD 484 A ++++G L + ++F ++G + + ++ DR TG +G+GFI F PS D Sbjct: 16 ASPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPS-VVD 74 Query: 485 ATNKQIHTL 511 + H + Sbjct: 75 KVIEDTHVI 83 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/63 (28%), Positives = 37/63 (58%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 + +++VG + TV +L+++F+++G V +V+ D T S+G+GF+ F S + Sbjct: 107 KTKKIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDEL 166 Query: 488 TNK 496 +K Sbjct: 167 LSK 169 Score = 41.5 bits (93), Expect = 6e-04 Identities = 18/69 (26%), Positives = 35/69 (50%) Frame = +2 Query: 305 ARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAAD 484 A ++++G L + ++F ++G + + ++ DR TG +G+GFI F PS D Sbjct: 16 ASPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPS-VVD 74 Query: 485 ATNKQIHTL 511 + H + Sbjct: 75 KVIEDTHVI 83 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 45.2 bits (102), Expect = 5e-05 Identities = 22/62 (35%), Positives = 34/62 (54%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNKQ 499 L+V +L+ V L+E F FG V + DR+ L +G+G++EF A ADA Q Sbjct: 100 LHVDSLSRNVNEAHLKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEF---KARADAEKAQ 156 Query: 500 IH 505 ++ Sbjct: 157 LY 158 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 45.2 bits (102), Expect = 5e-05 Identities = 22/62 (35%), Positives = 34/62 (54%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNKQ 499 L+V +L+ V L+E F FG V + DR+ L +G+G++EF A ADA Q Sbjct: 100 LHVDSLSRNVNEAHLKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEF---KARADAEKAQ 156 Query: 500 IH 505 ++ Sbjct: 157 LY 158 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 45.2 bits (102), Expect = 5e-05 Identities = 25/64 (39%), Positives = 39/64 (60%), Gaps = 1/64 (1%) Frame = +2 Query: 290 VMASTARAAR-LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTS 466 V +TA R L++G+L + + L F+ G + SA+V+ ++ TG +GYGFIEF S Sbjct: 53 VQPTTADEIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFAS 112 Query: 467 PSAA 478 +AA Sbjct: 113 HAAA 116 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYF-SQFGPVQSARVVFDRSTGLSKGYGFIEFTSPS 472 ++VG+LA V L E F + + V+ A+VV DR TG +KGYGF+ F+ S Sbjct: 157 IFVGDLAADVTDYILLETFRASYPSVKGAKVVIDRVTGRTKGYGFVRFSDES 208 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 ++VG L +V L+ FSQ+G + ++ K GF++F+ S A +A Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYGEIVHVKI------PAGKRCGFVQFSEKSCAEEA 312 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 45.2 bits (102), Expect = 5e-05 Identities = 25/64 (39%), Positives = 39/64 (60%), Gaps = 1/64 (1%) Frame = +2 Query: 290 VMASTARAAR-LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTS 466 V +TA R L++G+L + + L F+ G + SA+V+ ++ TG +GYGFIEF S Sbjct: 53 VQPTTADEIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFAS 112 Query: 467 PSAA 478 +AA Sbjct: 113 HAAA 116 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYF-SQFGPVQSARVVFDRSTGLSKGYGFIEFTSPS 472 ++VG+LA V L E F + + V+ A+VV DR TG +KGYGF+ F+ S Sbjct: 157 IFVGDLAADVTDYILLETFRASYPSVKGAKVVIDRVTGRTKGYGFVRFSDES 208 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/60 (30%), Positives = 34/60 (56%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 + +L++ L++ + LR F FG + +++ D+ + SKGY F+E+T+ AA A Sbjct: 280 KTKKLFITGLSFYTSEKTLRAAFEGFGELVEVKIIMDKISKRSKGYAFLEYTTEEAAGTA 339 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 44.8 bits (101), Expect = 6e-05 Identities = 26/65 (40%), Positives = 34/65 (52%) Frame = +2 Query: 293 MASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPS 472 MA + +YV NL TV L FSQ+G V S V+ D G S+G+GF+ F +P Sbjct: 195 MAGNQDSTNVYVKNLIETVTDDCLHTLFSQYGTVSSVVVMRD-GMGRSRGFGFVNFCNPE 253 Query: 473 AAADA 487 A A Sbjct: 254 NAKKA 258 Score = 42.3 bits (95), Expect = 3e-04 Identities = 26/82 (31%), Positives = 39/82 (47%) Frame = +2 Query: 314 ARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATN 493 A LYV NL ++ L F FG + S +VV G SKG+GF++F + +A A + Sbjct: 112 ANLYVKNLDSSITSSCLERMFCPFGSILSCKVV--EENGQSKGFGFVQFDTEQSAVSARS 169 Query: 494 KQIHTLKVST*VFNCKIIRYSE 559 ++ +F K I E Sbjct: 170 ALHGSMVYGKKLFVAKFINKDE 191 Score = 41.9 bits (94), Expect = 4e-04 Identities = 21/53 (39%), Positives = 34/53 (64%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTS 466 R + LYV NL+ ++ +LRE F +G + SA+V+ G SKG+GF+ F++ Sbjct: 302 RWSNLYVKNLSESMNETRLREIFGCYGQIVSAKVMC-HENGRSKGFGFVCFSN 353 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 44.8 bits (101), Expect = 6e-05 Identities = 23/57 (40%), Positives = 29/57 (50%) Frame = +2 Query: 326 VGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 V NL+ L E F FG V V D+ TG+S+G+GF+ F S A A NK Sbjct: 217 VTNLSEDTREPDLMELFHPFGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRAINK 273 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/50 (36%), Positives = 31/50 (62%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTS 466 +L+VG +A L++YFS++G V A V ++ TG +G+GF+ F + Sbjct: 7 KLFVGGIAKETSEEALKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRFAN 56 Score = 42.7 bits (96), Expect = 2e-04 Identities = 18/70 (25%), Positives = 32/70 (45%) Frame = +2 Query: 302 TARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAA 481 T+R +++VG L+ + + YF +FG V+ D T +G+GF+ + S + Sbjct: 116 TSRTKKIFVGGLSSNTTEEEFKSYFERFGRTTDVVVMHDGVTNRPRGFGFVTYDSEDSVE 175 Query: 482 DATNKQIHTL 511 H L Sbjct: 176 VVMQSNFHEL 185 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 44.8 bits (101), Expect = 6e-05 Identities = 23/56 (41%), Positives = 33/56 (58%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 L+VG+L + L FS V S +V+ ++ T S+GYGF+EF S SAA +A Sbjct: 121 LWVGDLLHWMDETYLHTCFSHTNEVSSVKVIRNKQTCQSEGYGFVEFLSRSAAEEA 176 Score = 43.6 bits (98), Expect = 1e-04 Identities = 22/48 (45%), Positives = 32/48 (66%), Gaps = 1/48 (2%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFS-QFGPVQSARVVFDRSTGLSKGYGFIEF 460 ++VG+LA V L E F+ ++ V+ A+VV D +TG SKGYGF+ F Sbjct: 215 IFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDSNTGRSKGYGFVRF 262 Score = 31.5 bits (68), Expect = 0.61 Identities = 18/56 (32%), Positives = 29/56 (51%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 ++VG L V L + FS FG V S ++ + KG GF++F + +A +A Sbjct: 329 IFVGGLDADVTEEDLMQPFSDFGEVVSVKI------PVGKGCGFVQFANRQSAEEA 378 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 44.4 bits (100), Expect = 8e-05 Identities = 21/66 (31%), Positives = 36/66 (54%) Frame = +2 Query: 299 STARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 S+ A R+Y+GN+ TV + QL + + G V+ +V++D+ +G S+ +GF S A Sbjct: 71 SSEAARRVYIGNIPRTVTNEQLTKLVEEHGAVEKVQVMYDKYSGRSRRFGFATMKSVEDA 130 Query: 479 ADATNK 496 K Sbjct: 131 NAVVEK 136 Score = 44.4 bits (100), Expect = 8e-05 Identities = 23/50 (46%), Positives = 30/50 (60%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTS 466 ++YVGNLA TV L FS+ G V SA+V T S G+GF+ F+S Sbjct: 178 KVYVGNLAKTVTKEMLENLFSEKGKVVSAKVSRVPGTSKSTGFGFVTFSS 227 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/64 (34%), Positives = 35/64 (54%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNKQ 499 L+VG L+ LRE S++G +++ R+V TG S+GYGF+E+ + A Sbjct: 66 LFVGRLSHHTTEDTLREVMSKYGRIKNLRLVRHIVTGASRGYGFVEYETEKEMLRAYEDA 125 Query: 500 IHTL 511 H+L Sbjct: 126 HHSL 129 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +++V L W L F +G ++ VV D++TG +KG+GF+ F + A +A Sbjct: 105 KIFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEA 161 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +++V L W L F +G ++ VV D++TG +KG+GF+ F + A +A Sbjct: 105 KIFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEA 161 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 44.0 bits (99), Expect = 1e-04 Identities = 27/68 (39%), Positives = 36/68 (52%) Frame = +2 Query: 314 ARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATN 493 A +YVG L + L E F Q GPV + V DR T L + YGFIE+ S AD Sbjct: 25 ATVYVGGLDAQLSEELLWELFVQAGPVVNVYVPKDRVTNLHQNYGFIEYRS-EEDADYAI 83 Query: 494 KQIHTLKV 517 K ++ +K+ Sbjct: 84 KVLNMIKL 91 Score = 41.9 bits (94), Expect = 4e-04 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = +2 Query: 314 ARLYVGNLAWTVGHRQLREYFSQFGPVQS-ARVVFDRSTGLSKGYGFIEFTSPSAA 478 A L++GNL V + L + FS FG + S +++ D TG S+G+GFI + S A+ Sbjct: 112 ANLFIGNLDPDVDEKLLYDTFSAFGVIASNPKIMRDPDTGNSRGFGFISYDSFEAS 167 >At2g21690.1 68415.m02580 RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 117 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/55 (32%), Positives = 31/55 (56%) Frame = +2 Query: 323 YVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +V L + L + FS+FG V +++++DR TG S+ +GF+ F + DA Sbjct: 10 FVRGLDQDTDEKDLTDIFSKFGNVIDSKIIYDRDTGKSRRFGFVTFEEEKSMTDA 64 >At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing protein low similarity to heterogeneous nuclear ribonucleoprotein G [Mus musculus] GI:5579009; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 152 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/56 (35%), Positives = 32/56 (57%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 A+++ V NL ++ L+ FS FG + +++ D + SKGY FI+FTS A Sbjct: 39 ASKIMVRNLPFSTSEDFLKREFSAFGEIAEVKLIKDEAMKRSKGYAFIQFTSQDDA 94 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/57 (36%), Positives = 32/57 (56%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 R+Y+GNLAW R +R+ FS + S R+ ++ TG KGY ++F + A A Sbjct: 263 RVYIGNLAWDTTERDIRKLFSDC-VINSVRLGKNKETGEFKGYAHVDFKDSVSVAIA 318 Score = 27.9 bits (59), Expect = 7.5 Identities = 15/57 (26%), Positives = 22/57 (38%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +LYVG + + ++R YF G + G G FI F + A A Sbjct: 162 KLYVGGIPYQSTEDEIRSYFRSCGVIIKVDCKMRPEDGAFSGIAFITFDTEDGAKRA 218 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 42.7 bits (96), Expect = 2e-04 Identities = 22/57 (38%), Positives = 28/57 (49%) Frame = +2 Query: 326 VGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 V NL+ L E F FG V V D+ T +S+G+GF+ F S A A NK Sbjct: 178 VTNLSEDTRGPDLMELFRPFGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRAINK 234 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 42.3 bits (95), Expect = 3e-04 Identities = 20/66 (30%), Positives = 39/66 (59%), Gaps = 3/66 (4%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTS---PSAAADAT 490 L+V + +V +L++ FS+FG V + +++ + T S GYG++ F S +A +A Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFGQVTNVKIIANERTRQSLGYGYVWFNSKEDAQSAVEAM 119 Query: 491 NKQIHT 508 N ++H+ Sbjct: 120 NGKVHS 125 >At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing protein low similarity to glycine-rich RNA-binding protein [Euphorbia esula] GI:2645699; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 337 Score = 41.9 bits (94), Expect = 4e-04 Identities = 21/56 (37%), Positives = 33/56 (58%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +YVG L + + +R FS +G V + ++V DRS K YGF+ F++ +A DA Sbjct: 9 VYVGGLPYDITEEAVRRVFSIYGSVLTVKIVNDRSV-RGKCYGFVTFSNRRSADDA 63 >At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing protein Length = 573 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/54 (37%), Positives = 30/54 (55%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAA 481 L+VG L W ++ SQ+G V+ + +R +G SKGY +EF +AAA Sbjct: 204 LFVGELHWWTTDAEIESVLSQYGRVKEIKFFDERVSGKSKGYCQVEFYDSAAAA 257 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 41.5 bits (93), Expect = 6e-04 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 4/69 (5%) Frame = +2 Query: 302 TARAARLYVGNLAWTVGHRQLREYFSQFGPVQS----ARVVFDRSTGLSKGYGFIEFTSP 469 T+ ++VG+L+ V L + FS F S ARV++D+ TG S+G+GF+ F + Sbjct: 144 TSSHFNIFVGDLSPEVTDAALFDSFSAFNSCSSYYRDARVMWDQKTGRSRGFGFVSFRNQ 203 Query: 470 SAAADATNK 496 A A N+ Sbjct: 204 QDAQTAINE 212 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVV-FDRSTGLSKGYGFIEFTSPSAAADA 487 +Y GN+ V L+E F+ GP++S +++ D+S+ YGF+ + A+ A Sbjct: 65 VYAGNIHTQVTEILLQEIFASTGPIESCKLIRKDKSS-----YGFVHYFDRRCASMA 116 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 41.5 bits (93), Expect = 6e-04 Identities = 21/65 (32%), Positives = 36/65 (55%) Frame = +2 Query: 302 TARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAA 481 T+ ++VG+L+ V L FS + ARV++D+ TG S+G+GF+ F + A Sbjct: 135 TSSHFNIFVGDLSPEVTDAMLFTCFSVYPTCSDARVMWDQKTGRSRGFGFVSFRNQQDAQ 194 Query: 482 DATNK 496 A ++ Sbjct: 195 TAIDE 199 Score = 31.5 bits (68), Expect = 0.61 Identities = 19/61 (31%), Positives = 30/61 (49%) Frame = +2 Query: 299 STARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 + A+ +YVGNLA V L +F G A V+ + KG+GF+ +++ A Sbjct: 255 NNAQYTTVYVGNLAPEVSQVDLHRHFHSLG----AGVIEEVRVQRDKGFGFVRYSTHVEA 310 Query: 479 A 481 A Sbjct: 311 A 311 Score = 30.7 bits (66), Expect = 1.1 Identities = 18/54 (33%), Positives = 30/54 (55%) Frame = +2 Query: 299 STARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEF 460 ST R+ +YVGN+ V L+E F+ GPV+S +++ + YGF+ + Sbjct: 51 STCRS--VYVGNIHIQVTEPLLQEVFAGTGPVESCKLIRKEKS----SYGFVHY 98 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/57 (35%), Positives = 31/57 (54%) Frame = +2 Query: 290 VMASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEF 460 V A L++ N+ G ++L F FG V SA+V D++TG+SK +G + F Sbjct: 340 VQTEGPEGANLFIYNIPREFGDQELAAAFQSFGIVLSAKVFVDKATGVSKCFGKLSF 396 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/61 (26%), Positives = 27/61 (44%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADAT 490 + +L+VG + + QL F +F V ++ D+ T S+G F+ S A Sbjct: 17 SVKLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLV 76 Query: 491 N 493 N Sbjct: 77 N 77 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 41.1 bits (92), Expect = 8e-04 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVV-FDRSTGLSKGYGFIEFTSPSAAADA 487 L+ GNL++ + + +F + G V R+ FD G KGYG IEF SP A A Sbjct: 386 LFAGNLSYQIARSDIENFFKEAGEVVDVRLSSFD--DGSFKGYGHIEFASPEEAQKA 440 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 4/58 (6%) Frame = +2 Query: 305 ARAARLYVGNLAWTVGH----RQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTS 466 +++ +YV + ++G ++LR +FS+ G V V DR TG S+G+ +I+ TS Sbjct: 476 SQSRTIYVRGFSSSLGEDEIKKELRSHFSKCGEVTRVHVPTDRETGASRGFAYIDLTS 533 >At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 674 Score = 41.1 bits (92), Expect = 8e-04 Identities = 21/61 (34%), Positives = 33/61 (54%) Frame = +2 Query: 305 ARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAAD 484 A + ++V N+ + L +F++FG V A +V D +TG G +IEFT AA + Sbjct: 513 ASSRTIFVANVHFGATKDSLSRHFNKFGEVLKAFIVTDPATGQPSGSAYIEFTRKEAAEN 572 Query: 485 A 487 A Sbjct: 573 A 573 >At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing protein Length = 710 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/56 (33%), Positives = 32/56 (57%) Frame = +2 Query: 314 ARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAA 481 A L+VG+L W +L ++G V+ + ++++G SKGY +EF P AA+ Sbjct: 234 AFLFVGDLHWWTTDAELEAELCKYGAVKEVKFFDEKASGKSKGYCQVEFYDPVAAS 289 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/45 (42%), Positives = 26/45 (57%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGF 451 R++VG L + Q+RE FG ++ +V DR TG SKGY F Sbjct: 360 RIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSKGYAF 404 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/45 (42%), Positives = 26/45 (57%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGF 451 R++VG L + Q+RE FG ++ +V DR TG SKGY F Sbjct: 360 RIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSKGYAF 404 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/45 (42%), Positives = 26/45 (57%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGF 451 R++VG L + Q+RE FG ++ +V DR TG SKGY F Sbjct: 360 RIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSKGYAF 404 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/71 (26%), Positives = 38/71 (53%) Frame = +2 Query: 293 MASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPS 472 ++ + +L+VG++ T ++R YF Q G V ++ D+ TG +G F+++ + S Sbjct: 113 VSDRSSTVKLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYAT-S 171 Query: 473 AAADATNKQIH 505 AD + +H Sbjct: 172 KDADRAIRALH 182 Score = 34.3 bits (75), Expect = 0.087 Identities = 18/57 (31%), Positives = 32/57 (56%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +L+VG+L +++ E F QFG V+ ++ D S+G GF++++S A A Sbjct: 212 KLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYR-QSRGCGFVKYSSKETAMAA 267 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/71 (26%), Positives = 38/71 (53%) Frame = +2 Query: 293 MASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPS 472 ++ + +L+VG++ T ++R YF Q G V ++ D+ TG +G F+++ + S Sbjct: 113 VSDRSSTVKLFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYAT-S 171 Query: 473 AAADATNKQIH 505 AD + +H Sbjct: 172 KDADRAIRALH 182 Score = 34.3 bits (75), Expect = 0.087 Identities = 18/57 (31%), Positives = 32/57 (56%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +L+VG+L +++ E F QFG V+ ++ D S+G GF++++S A A Sbjct: 212 KLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYR-QSRGCGFVKYSSKETAMAA 267 >At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing protein low similarity to enhancer binding protein-1; EBP1 [Entamoeba histolytica] GI:8163877, SP|P19682 28 kDa ribonucleoprotein, chloroplast precursor (28RNP) {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYF-SQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 L+V NLA+ + L+E+F + G V S V+F + S GYGF+ F + A A Sbjct: 191 LFVANLAFEARAKHLKEFFDADTGNVVSTEVIFHENPRRSSGYGFVSFKTKKQAEAA 247 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = +2 Query: 296 ASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEF 460 A +A +YVG + + + L FSQ+G + ++ D+ TG SKG+ F+ + Sbjct: 30 AKYKNSAYVYVGGIPFDLTEGDLLAVFSQYGEIVDVNLIRDKGTGKSKGFAFLAY 84 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/69 (26%), Positives = 38/69 (55%) Frame = +2 Query: 299 STARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 S +A + V L+ L + +++GP+ RV+ ++++G+S+G+ FI+F + AA Sbjct: 293 SATPSATVVVKGLSMKSTEEDLYQILAEWGPLHHVRVIREQNSGISRGFAFIDFPTVDAA 352 Query: 479 ADATNKQIH 505 ++ H Sbjct: 353 RTMMDRIEH 361 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 LYV NL +++ + + FS FG V V+ DR T S+G F+ + S AA A Sbjct: 59 LYVSNLDFSLTNSDIHTLFSTFGKVARVTVLKDRHTRQSRGVAFVLYVSREDAAKA 114 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/56 (32%), Positives = 32/56 (57%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 L+V + +V +L++ FS+FG V + +++ + T S GYG++ F S A A Sbjct: 79 LFVKGFSDSVSEGRLKKVFSEFGQVTNVKIIANERTRQSLGYGYVWFNSKEDAQSA 134 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/56 (33%), Positives = 29/56 (51%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 L V N+ +LRE F +FGPV+ + D +G +G+ F+EF A +A Sbjct: 49 LLVRNIPLDCRPEELREPFERFGPVRDVYIPRDYYSGQPRGFAFVEFVDAYDAGEA 104 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/66 (25%), Positives = 32/66 (48%) Frame = +2 Query: 290 VMASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSP 469 ++A + +Y+G + L+ + G V R++ ++ +G KGY F+ F S Sbjct: 84 LLALPPHGSEVYLGGIPTDATEGDLKGFCGSIGEVTEVRIMREKDSGDGKGYAFVTFRSK 143 Query: 470 SAAADA 487 AA+A Sbjct: 144 DLAAEA 149 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 38.3 bits (85), Expect = 0.005 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEF 460 L+V L + +++ F +GP++ +V D+ T KGY FIE+ Sbjct: 140 LFVSRLNYESSESKIKREFESYGPIKRVHLVTDQLTNKPKGYAFIEY 186 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 38.3 bits (85), Expect = 0.005 Identities = 16/34 (47%), Positives = 23/34 (67%) Frame = +2 Query: 362 LREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFT 463 LRE+FS G +++ V DR TG SKG ++EF+ Sbjct: 421 LREHFSSCGEIKNVSVPIDRDTGNSKGIAYLEFS 454 Score = 36.7 bits (81), Expect = 0.016 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 L+ NL++ + + +F + G V R +R G +G+G +EF S A A Sbjct: 299 LFAANLSFNIERADVENFFKEAGEVVDVRFSTNRDDGSFRGFGHVEFASSEEAQKA 354 >At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28) nearly identical to SC35-like splicing factor SCL28, 28 kD [Arabidopsis thaliana] GI:9843655; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 236 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/62 (29%), Positives = 32/62 (51%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNKQ 499 L + NL LR+ F +FGP++ + + TG +G+GF+++ AA+A + Sbjct: 49 LLIRNLPLDARPNDLRDSFERFGPLKDIYLPRNYYTGEPRGFGFVKYRYAEDAAEAMKRM 108 Query: 500 IH 505 H Sbjct: 109 NH 110 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 37.9 bits (84), Expect = 0.007 Identities = 23/58 (39%), Positives = 30/58 (51%) Frame = +2 Query: 314 ARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +R+YVGNL V R+L + F FG V+S V GY F++F P A DA Sbjct: 2 SRVYVGNLDPRVTERELEDEFRAFGVVRSVWV-----ARRPPGYAFLDFEDPRDARDA 54 >At5g02530.1 68418.m00187 RNA and export factor-binding protein, putative BcDNA.LD24793, Drosophila melanogaster, EMBL:AF172637 Length = 292 Score = 37.5 bits (83), Expect = 0.009 Identities = 20/67 (29%), Positives = 35/67 (52%) Frame = +2 Query: 296 ASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSA 475 +S +LY+ NL + V + ++E FS+ G ++ + +DRS G SKG + F+ Sbjct: 102 SSIETGTKLYISNLDYGVSNEDIKELFSEVGDLKRYGIHYDRS-GRSKGTAEVVFSRRGD 160 Query: 476 AADATNK 496 A A + Sbjct: 161 ALAAVKR 167 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 37.5 bits (83), Expect = 0.009 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +2 Query: 302 TARAAR-LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 ++R++R +YVGNL + R++ + FS++GPV + + GY F+EF A Sbjct: 2 SSRSSRTIYVGNLPGDIREREVEDLFSKYGPVVQIDL---KIPPRPPGYAFVEFEDARDA 58 Query: 479 ADA 487 DA Sbjct: 59 DDA 61 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 37.5 bits (83), Expect = 0.009 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +2 Query: 302 TARAAR-LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 ++R++R +YVGNL + R++ + FS++GPV + + GY F+EF A Sbjct: 2 SSRSSRTIYVGNLPGDIREREVEDLFSKYGPVVQIDL---KIPPRPPGYAFVEFEDARDA 58 Query: 479 ADA 487 DA Sbjct: 59 DDA 61 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 37.5 bits (83), Expect = 0.009 Identities = 16/50 (32%), Positives = 31/50 (62%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEF 460 AA + V L +++ + QL E FS+ GPV+ +V ++ + +G+ F++F Sbjct: 19 AATVCVSGLPYSITNAQLEEAFSEVGPVRRCFLVTNKGSDEHRGFAFVKF 68 Score = 37.1 bits (82), Expect = 0.012 Identities = 21/66 (31%), Positives = 33/66 (50%) Frame = +2 Query: 299 STARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 S A+ +L + NL + ++ FS G V + + TGL KG+ F++FT A Sbjct: 326 SKAQKWKLIIRNLPFQAKPSDIKVVFSAVGFVWDVFIPKNFETGLPKGFAFVKFTCKKDA 385 Query: 479 ADATNK 496 A+A K Sbjct: 386 ANAIKK 391 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/64 (28%), Positives = 31/64 (48%) Frame = +2 Query: 296 ASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSA 475 +S+ +LYV L++ LR+ F QFG + +V D+ KG+ F+ + + Sbjct: 71 SSSGPKTKLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDKVANRPKGFAFLRYETEEE 130 Query: 476 AADA 487 A A Sbjct: 131 AMKA 134 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 37.5 bits (83), Expect = 0.009 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTS 466 LYV L+ V R L ++F++ G V +V D T S+G+GFI S Sbjct: 47 LYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKS 95 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 37.5 bits (83), Expect = 0.009 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTS 466 LYV L+ V R L ++F++ G V +V D T S+G+GFI S Sbjct: 77 LYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKS 125 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 37.5 bits (83), Expect = 0.009 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +2 Query: 302 TARAAR-LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 ++R++R +YVGNL + R++ + FS++GPV + + GY F+EF A Sbjct: 2 SSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDL---KVPPRPPGYAFVEFDDARDA 58 Query: 479 ADA 487 DA Sbjct: 59 EDA 61 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 37.5 bits (83), Expect = 0.009 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +2 Query: 302 TARAAR-LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 ++R++R +YVGNL + R++ + FS++GPV + + GY F+EF A Sbjct: 2 SSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDL---KVPPRPPGYAFVEFDDARDA 58 Query: 479 ADA 487 DA Sbjct: 59 EDA 61 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 37.5 bits (83), Expect = 0.009 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +2 Query: 302 TARAAR-LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 ++R++R +YVGNL + R++ + FS++GPV + + GY F+EF A Sbjct: 2 SSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDL---KVPPRPPGYAFVEFDDARDA 58 Query: 479 ADA 487 DA Sbjct: 59 EDA 61 >At5g59950.3 68418.m07518 RNA and export factor-binding protein, putative Length = 242 Score = 36.7 bits (81), Expect = 0.016 Identities = 21/67 (31%), Positives = 34/67 (50%) Frame = +2 Query: 296 ASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSA 475 A +LY+ NL + V + ++E F++ G ++ V FDRS G SKG + ++ Sbjct: 80 AGIETGTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRS-GRSKGTAEVVYSRRGD 138 Query: 476 AADATNK 496 A A K Sbjct: 139 ALAAVKK 145 >At5g59950.2 68418.m07519 RNA and export factor-binding protein, putative Length = 178 Score = 36.7 bits (81), Expect = 0.016 Identities = 21/67 (31%), Positives = 34/67 (50%) Frame = +2 Query: 296 ASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSA 475 A +LY+ NL + V + ++E F++ G ++ V FDRS G SKG + ++ Sbjct: 16 AGIETGTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRS-GRSKGTAEVVYSRRGD 74 Query: 476 AADATNK 496 A A K Sbjct: 75 ALAAVKK 81 >At5g59950.1 68418.m07517 RNA and export factor-binding protein, putative Length = 244 Score = 36.7 bits (81), Expect = 0.016 Identities = 21/67 (31%), Positives = 34/67 (50%) Frame = +2 Query: 296 ASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSA 475 A +LY+ NL + V + ++E F++ G ++ V FDRS G SKG + ++ Sbjct: 82 AGIETGTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRS-GRSKGTAEVVYSRRGD 140 Query: 476 AADATNK 496 A A K Sbjct: 141 ALAAVKK 147 >At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, putative Length = 506 Score = 36.7 bits (81), Expect = 0.016 Identities = 24/64 (37%), Positives = 30/64 (46%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNKQ 499 L+V L L FS+FG V SA V+ D TG S Y FIEF + + A K Sbjct: 245 LFVCKLNPVTEDEDLHTIFSRFGTVVSADVIRDFKTGDSLCYAFIEFENKESCEQAYFKM 304 Query: 500 IHTL 511 + L Sbjct: 305 DNAL 308 >At5g48650.1 68418.m06016 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein Length = 458 Score = 36.3 bits (80), Expect = 0.021 Identities = 18/60 (30%), Positives = 26/60 (43%) Frame = +2 Query: 299 STARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 + A +YV +L + L F QFG + + + GL YGF+EF AA Sbjct: 314 AVAEGTSIYVRHLPFNANIDMLEAEFKQFGAITNGGIQVINQRGLGYPYGFVEFEEADAA 373 >At1g45100.1 68414.m05170 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Nicotiana tabacum] GI:7673355, [Cucumis sativus] GI:7528270; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 497 Score = 36.3 bits (80), Expect = 0.021 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 3/70 (4%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNKQ 499 L+V NL ++ + +F G V R++ + S G G+GF+EF S + A A K Sbjct: 249 LFVANLRDSIQISDIINFFKDVGEVVHVRLIVN-SQGKHAGWGFVEFASANEAEKALVKN 307 Query: 500 ---IHTLKVS 520 +H K+S Sbjct: 308 GEYLHNYKIS 317 Score = 29.9 bits (64), Expect = 1.9 Identities = 18/58 (31%), Positives = 28/58 (48%) Frame = +2 Query: 326 VGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNKQ 499 V NL+ ++ +F+ V S R+V + G GYGF+EF S A A ++ Sbjct: 162 VSNLSPLTKIAHIKGFFNGVAQVVSVRLVVNHE-GKHVGYGFVEFASAYGANKALEEK 218 >At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 952 Score = 35.9 bits (79), Expect = 0.028 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVV-FDRSTGLSKGYGFIEFTSPSAAADA 487 +++VGNL + + E+F QFGP+++ ++ + G+GFI + + +A A Sbjct: 166 KIFVGNLPTWIKKPEFEEFFRQFGPIENVILIKGHHEVEKNAGFGFIIYAAEKSAMKA 223 >At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 284 Score = 35.9 bits (79), Expect = 0.028 Identities = 21/57 (36%), Positives = 28/57 (49%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 RLYVG L+ R L FS++G V R + + Y F+EF+ P A DA Sbjct: 12 RLYVGRLSSRTRTRDLERLFSRYGRV--------RDVDMKRDYAFVEFSDPRDADDA 60 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 35.5 bits (78), Expect = 0.037 Identities = 17/66 (25%), Positives = 35/66 (53%) Frame = +2 Query: 290 VMASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSP 469 ++ S + ++ L+V ++++ L + FSQ+G V V+ D+ KG+ ++ F+S Sbjct: 13 LLFSRSFSSTLFVKGISFSSTEETLTQAFSQYGQVLKVDVIMDKIRCRPKGFAYVTFSSK 72 Query: 470 SAAADA 487 A A Sbjct: 73 EEAEKA 78 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 34.7 bits (76), Expect = 0.065 Identities = 22/56 (39%), Positives = 28/56 (50%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 LY+ NL V L FS FG V + + D G S+G+ FIEF S +A A Sbjct: 19 LYIANLDAQVSEEMLFLMFSDFGKVIRSVLAKD-FRGESRGFAFIEFESADSAGRA 73 >At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 290 Score = 34.7 bits (76), Expect = 0.065 Identities = 21/57 (36%), Positives = 27/57 (47%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 RLYVG L+ R L FS++G V R + + Y F+EF P A DA Sbjct: 12 RLYVGRLSSRTRTRDLERLFSRYGRV--------RDVDMKRDYAFVEFGDPRDADDA 60 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 34.7 bits (76), Expect = 0.065 Identities = 21/58 (36%), Positives = 29/58 (50%) Frame = +2 Query: 314 ARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +R+YVGNL V R+L + F FG ++S V GY F++F A DA Sbjct: 2 SRVYVGNLDPRVTERELEDEFRSFGVIRSVWV-----ARRPPGYAFLDFEDSRDARDA 54 >At5g10350.2 68418.m01201 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 34.3 bits (75), Expect = 0.087 Identities = 16/59 (27%), Positives = 30/59 (50%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 A +YVGN+ + +++ +F G V ++ D+ G KG+ ++EF A +A Sbjct: 88 ARSVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMDK-FGQPKGFAYVEFVEVEAVQEA 145 >At5g10350.1 68418.m01200 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 217 Score = 34.3 bits (75), Expect = 0.087 Identities = 16/59 (27%), Positives = 30/59 (50%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 A +YVGN+ + +++ +F G V ++ D+ G KG+ ++EF A +A Sbjct: 88 ARSVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMDK-FGQPKGFAYVEFVEVEAVQEA 145 >At5g65260.1 68418.m08209 polyadenylate-binding protein family protein / PABP family protein low similarity to poly(A)-binding protein II [Drosophila melanogaster] GI:6007612; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 220 Score = 33.9 bits (74), Expect = 0.11 Identities = 15/59 (25%), Positives = 31/59 (52%) Frame = +2 Query: 311 AARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 A ++VGN+ + +++++F G V ++ D+ G KG+ ++EF A +A Sbjct: 91 ARSVFVGNVDYACTPEEVQQHFQTCGTVHRVTILTDKF-GQPKGFAYVEFVEVEAVQEA 148 >At5g51120.1 68418.m06339 polyadenylate-binding protein, putative / PABP, putative contains similarity to poly(A)-binding protein II [Mus musculus] GI:2351846; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 227 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/56 (25%), Positives = 30/56 (53%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +YVGN+ + +++++F G V ++ D+ G KG+ ++EF A ++ Sbjct: 105 IYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDK-FGQPKGFAYVEFVEVEAVQNS 159 >At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing protein KIAA0332 - Homo sapiens, EMBL:AB002330 Length = 946 Score = 33.9 bits (74), Expect = 0.11 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVF---DRSTGLSKGYGFIEF 460 + LYVGNL+ V L F +FGP+ S ++++ D + GF+ F Sbjct: 177 QTTNLYVGNLSPKVDENFLLRTFGRFGPIASVKIMWPRTDEEKRRQRNCGFVSF 230 >At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 141 Score = 33.5 bits (73), Expect = 0.15 Identities = 16/49 (32%), Positives = 28/49 (57%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTS 466 LYV L+ V + L +F++ G V S +V + T +S+G+ F+ +S Sbjct: 74 LYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSS 122 >At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 140 Score = 33.5 bits (73), Expect = 0.15 Identities = 16/49 (32%), Positives = 28/49 (57%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTS 466 LYV L+ V + L +F++ G V S +V + T +S+G+ F+ +S Sbjct: 73 LYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSS 121 >At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 33.5 bits (73), Expect = 0.15 Identities = 21/57 (36%), Positives = 28/57 (49%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 R+YVGNL V R+L + F FG +++ V GY F+EF A DA Sbjct: 3 RVYVGNLDPRVTERELEDEFKAFGVLRNVWV-----ARRPPGYAFLEFDDERDALDA 54 >At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 33.5 bits (73), Expect = 0.15 Identities = 21/57 (36%), Positives = 28/57 (49%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 R+YVGNL V R+L + F FG +++ V GY F+EF A DA Sbjct: 3 RVYVGNLDPRVTERELEDEFKAFGVLRNVWV-----ARRPPGYAFLEFDDERDALDA 54 >At5g41690.1 68418.m05067 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GI:7673355 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 620 Score = 33.1 bits (72), Expect = 0.20 Identities = 21/61 (34%), Positives = 33/61 (54%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNKQ 499 L+V NL+ + ++F+ G V S R++ + G GYGF+EF A+AD T K Sbjct: 246 LFVANLSPQTKISDIFDFFNCVGEVVSIRLMVNHE-GKHVGYGFVEF----ASADETKKA 300 Query: 500 I 502 + Sbjct: 301 L 301 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 33.1 bits (72), Expect = 0.20 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 3/64 (4%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGP--VQSARVVFD-RSTGLSKGYGFIEFTSPSAAADAT 490 L+VGN+ LRE +G + +V D + +++GY F+EF+S S A DA Sbjct: 296 LFVGNICKIWTPEALREKLKHYGVENMDDITLVEDSNNVNMNRGYAFLEFSSRSDAMDAH 355 Query: 491 NKQI 502 + + Sbjct: 356 KRLV 359 Score = 31.9 bits (69), Expect = 0.46 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 ++VG+L L++ F G V R++ + T SKG F+ F + A A + Sbjct: 216 IFVGSLDKGASEEDLKKVFGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKRAVKE 274 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 33.1 bits (72), Expect = 0.20 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +YVGNL + ++ + F ++GP+ + + GY F+EF P A DA Sbjct: 9 IYVGNLPGDIRKCEVEDLFYKYGPIVDIDL---KIPPRPPGYAFVEFEDPRDADDA 61 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 32.3 bits (70), Expect = 0.35 Identities = 19/63 (30%), Positives = 27/63 (42%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNKQ 499 +YVGN + H L FS+FG V + + GY F+ F A DA + Sbjct: 4 VYVGNFDYDTRHSDLERLFSKFGRV--------KRVDMKSGYAFVYFEDERDAEDAIRRT 55 Query: 500 IHT 508 +T Sbjct: 56 DNT 58 >At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing protein contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 173 Score = 31.9 bits (69), Expect = 0.46 Identities = 18/62 (29%), Positives = 29/62 (46%) Frame = +2 Query: 293 MASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPS 472 M+ T+ +Y+GN+ V R L + Q G V + D+ T KG+ F E+ + Sbjct: 1 MSGTSNCT-VYIGNVDERVSDRVLYDIMIQAGRVIDLHIPRDKETDKPKGFAFAEYETEE 59 Query: 473 AA 478 A Sbjct: 60 IA 61 >At3g48830.1 68416.m05333 polynucleotide adenylyltransferase family protein / RNA recognition motif (RRM)-containing protein similar to SP|P13685 Poly(A) polymerase (EC 2.7.7.19) {Escherichia coli O157:H7}; contains Pfam profiles PF01743: polyA polymerase family protein, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 881 Score = 31.9 bits (69), Expect = 0.46 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +2 Query: 368 EYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNKQ 499 ++F+ G V S R++ + GYGF+EF SP A A K+ Sbjct: 700 DFFNDVGEVVSVRLIVSPESK-HVGYGFVEFASPCLANMALEKK 742 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +2 Query: 368 EYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 ++F G V + R++ D+ G G GF+EFTS A Sbjct: 829 DFFKDAGQVVNVRLIVDQK-GKPFGRGFVEFTSADEA 864 >At5g37720.1 68418.m04541 RNA and export factor-binding protein, putative transcriptional coactivator ALY, Mus musculus, EMBL:MMU89876 Length = 288 Score = 31.5 bits (68), Expect = 0.61 Identities = 20/65 (30%), Positives = 32/65 (49%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 RL+V NL V + +RE FS+ G V+ + +D++ G G + + S A A K Sbjct: 94 RLHVTNLDQGVTNEDIRELFSEIGEVERYAIHYDKN-GRPSGTAEVVYPRRSDAFQALKK 152 Query: 497 QIHTL 511 + L Sbjct: 153 YNNVL 157 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 31.1 bits (67), Expect = 0.81 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 374 FSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 F FG +++ + DR +G KGY IE+ A A Sbjct: 115 FGDFGEIKNLNLNLDRRSGYVKGYALIEYEKKEEAQSA 152 >At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing protein Length = 90 Score = 30.7 bits (66), Expect = 1.1 Identities = 18/41 (43%), Positives = 20/41 (48%) Frame = +2 Query: 293 MASTARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVF 415 MAST YVGNL L+ FSQFG V + V F Sbjct: 1 MASTNVEFTCYVGNLESDTEENDLKNAFSQFGDVIHSNVRF 41 >At1g79100.1 68414.m09223 arginine/serine-rich protein-related similar to arginine/serine-rich protein [Arabidopsis thaliana] GI:6601502 Length = 70 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = +2 Query: 359 QLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNKQIH 505 ++R + FG + ++ DR+ LS+G ++EF + ADA Q++ Sbjct: 3 KIRVFRGDFGEIIHVQLAIDRAANLSRGDAYVEF--KAKIADAEKPQLY 49 >At5g60980.1 68418.m07649 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein G3BP ras-GTPase-activating protein SH3-domain binding protein, Mus musculus, EMBL:MMU65313 Length = 459 Score = 30.3 bits (65), Expect = 1.4 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +YV NL + QL E F FG ++ + RS +GF+EF + S A Sbjct: 295 IYVRNLPFDSTPTQLEEVFKNFGAIKHEGIQV-RSNKQGFCFGFVEFETSSGKQSA 349 >At3g63450.1 68416.m07144 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 399 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 368 EYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSP 469 +YFS FGPVQ R+ + + + +GF+ F P Sbjct: 174 DYFSTFGPVQDVRIPYQQ----KRMFGFVTFMYP 203 >At2g33440.1 68415.m04099 splicing factor family protein similar to Splicing factor U2AF 65 kDa subunit (U2 snRNP auxiliary factor large subunit) {Homo sapiens} SP|P26368, {Mus musculus} SP|P26369; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 247 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/57 (26%), Positives = 29/57 (50%) Frame = +2 Query: 317 RLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 ++++G + + L E S FGP+++ R F + L++ F+E+T S A Sbjct: 41 KIFIGGFSKAISSEMLMEIVSVFGPLKAYR--FVSNNDLNQRCAFLEYTDGSVTLKA 95 >At5g66010.1 68418.m08312 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to Heterogeneous nuclear ribonucleoprotein SP|P55795, SP|P31943, SP|P52597 {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 289 Score = 29.9 bits (64), Expect = 1.9 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADATNK 496 L + L ++V Q+ E+FS + +Q V R G + G F+EF + A A K Sbjct: 202 LKMRGLPYSVNKPQIIEFFSGYKVIQGRVQVVCRPDGKATGEAFVEFETGEEARRAMAK 260 >At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein G3BP ras-GTPase-activating protein SH3-domain binding protein, Mus musculus, EMBL:MMU65313 Length = 460 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 +YV NL + QL E F FG ++ + + +GF+EF + S A Sbjct: 295 IYVRNLPFDSTPTQLEEVFKNFGAIKHEGIQVRSNKQQGFCFGFVEFETSSGKQSA 350 >At5g10800.1 68418.m01255 RNA recognition motif (RRM)-containing protein KIAA0332 gene, Homo sapiens, EMBL:HSAB2330 Length = 947 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +2 Query: 308 RAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRS 424 + LYV NL+ V L F +FGP+ S ++++ R+ Sbjct: 185 QTTNLYVVNLSSKVDENFLLRTFGRFGPIASVKIMWPRT 223 >At3g51950.1 68416.m05698 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM), PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 540 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 371 YFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSP 469 YFS FGPVQ R+ + + + +GF+ F P Sbjct: 278 YFSTFGPVQDVRIPYQQ----KRMFGFVTFVYP 306 >At3g07250.1 68416.m00863 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF02136: Nuclear transport factor 2 (NTF2) domain Length = 1294 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +2 Query: 374 FSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 F QFGP++ R+ + Y F+EF AA A Sbjct: 570 FKQFGPIKKGRIRVINPANSNYWYAFVEFEEADAAKRA 607 Score = 27.5 bits (58), Expect = 9.9 Identities = 19/61 (31%), Positives = 25/61 (40%) Frame = +2 Query: 305 ARAARLYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAAD 484 A A + V NL + F QFG ++ V S YGF+EF +AA Sbjct: 1073 ANNAAICVKNLPLNATIALVENAFKQFGEIRRGGVEVRNKRSFS--YGFVEFKEENAAQR 1130 Query: 485 A 487 A Sbjct: 1131 A 1131 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = +2 Query: 356 RQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAAADA 487 + LR+ F+ F AR++ D+ T KG+GFI F S A A Sbjct: 85 QSLRQLFAPF-----ARLIKDQQTQRPKGFGFITFESEDDAQKA 123 >At5g53470.1 68418.m06645 acyl-CoA binding protein, putative / ACBP, putative similar to acyl-CoA binding protein 2 [Arabidopsis thaliana] gi|12039034|gb|AAG46057 Length = 338 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 5/52 (9%) Frame = +2 Query: 605 DSDFSDEDQSPLDSLFNKAADHLR-----KITNKLDNGQLLELYGLFKQGTE 745 D D+ + + LD F+ A + +++ K+ N L+LYGL+K TE Sbjct: 83 DDDWEGVESTELDEAFSAATAFVAAAASDRLSQKVSNELQLQLYGLYKIATE 134 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGY 445 L+VG + V L E FS+FG ++ R + +R T Y Sbjct: 252 LWVGGIGPNVSKDDLEEEFSKFGKIEDFRFLRERKTAFIDYY 293 >At5g28810.1 68418.m03542 hypothetical protein Length = 560 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 608 SDFSDEDQSPLDSLFNKA-ADHLRKITNKLDN 700 S F + +PLD + NKA AD LR + LDN Sbjct: 524 SSFEETFSNPLDQMANKATADALRALQEGLDN 555 >At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 501 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 320 LYVGNLAWTVGHRQLREYFSQFGPVQSARV 409 ++VGNL V + + + FS+FG V+S R+ Sbjct: 173 VFVGNLPLKVKKKVILKEFSKFGEVESVRI 202 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 27.9 bits (59), Expect = 7.5 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = +2 Query: 332 NLAWTVGHRQLREYFSQFGPVQSARVVFDRSTGLSKGYGFIEFTSPSAA 478 N A T H + + + + D + + GYGF+ TSP AA Sbjct: 436 NEAITEEHNKHESHHQPYSSYDFVYLPMDFNNKCNVGYGFVNMTSPEAA 484 >At1g72800.1 68414.m08416 nuM1-related contains similarity with nuM1 GI:1279563 from [Medicago sativa] Length = 335 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 362 LREYFSQFGPVQSARVVFDRSTGLSKGYGFIE 457 L +YFS FG + V TG S GY +I+ Sbjct: 254 LSKYFSSFGEITRVFVPPSHGTGGSLGYAYID 285 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,916,099 Number of Sequences: 28952 Number of extensions: 290737 Number of successful extensions: 1057 Number of sequences better than 10.0: 203 Number of HSP's better than 10.0 without gapping: 926 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1036 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -