BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20961 (639 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g17900.1 68417.m02668 zinc-binding family protein similar to ... 28 4.5 At1g62630.1 68414.m07066 disease resistance protein (CC-NBS-LRR ... 28 4.5 At3g11010.1 68416.m01329 disease resistance family protein / LRR... 28 6.0 >At4g17900.1 68417.m02668 zinc-binding family protein similar to zinc-binding protein [Pisum sativum] GI:16117799; contains Pfam profile PF04640 : Protein of unknown function, DUF597 Length = 227 Score = 28.3 bits (60), Expect = 4.5 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +1 Query: 499 KFHRKLNAELSSGYCKK-TKIPKAYLSLTNHKDHTEIELTHSELYSM 636 KFH + + YC T P L L +HKDH I++ S + + Sbjct: 50 KFHGDSHKSECNMYCLDCTNGPLCSLCLAHHKDHRTIQIRRSSYHDV 96 >At1g62630.1 68414.m07066 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 893 Score = 28.3 bits (60), Expect = 4.5 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 141 KGIHLINLLELSRFEQFLNRILVKLKMNNNEVFSQEEQK 257 KG+HL N L+ +F FL+ + K+++ N V QK Sbjct: 243 KGVHLFNFLKNKKFVLFLDDLWDKVELANIGVPDPRTQK 281 >At3g11010.1 68416.m01329 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to disease resistance protein [Lycopersicon esculentum] gi|3894383|gb|AAC78591 Length = 894 Score = 27.9 bits (59), Expect = 6.0 Identities = 19/64 (29%), Positives = 36/64 (56%), Gaps = 1/64 (1%) Frame = -1 Query: 456 SSIGLVSEDHTLTIT-SAFSSHNPRLFKSVLNVSGTKMNFNIFFNKYFNVLIHITKLSSS 280 SSIG +S+ L ++ + F P F ++ ++ ++FN + NVL+++T LS Sbjct: 196 SSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKLGGNFPNVLLNLTGLSVV 255 Query: 279 TLNN 268 +L+N Sbjct: 256 SLSN 259 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,961,811 Number of Sequences: 28952 Number of extensions: 216390 Number of successful extensions: 581 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 581 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1314848736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -