BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20959 (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasm... 25 3.0 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 25 3.0 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 3.9 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 23 6.8 >DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasmic carbonic anhydrase protein. Length = 276 Score = 24.6 bits (51), Expect = 3.0 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = +2 Query: 296 GPVLIATMWPQCRGSLETETHFCTNSTSRKSLVRRRMPKFRKWPKSTR 439 GP M+PQ RG ++ T+ T ++ ++ P++TR Sbjct: 12 GPQKWPEMFPQARGQRQSPVDIVTSKTQNSGDLQENPLRWTYVPENTR 59 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 24.6 bits (51), Expect = 3.0 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -3 Query: 105 LIVTTNHYSFFPVFLIWTVIIIIF 34 L+V NH P+FL T+ ++ F Sbjct: 613 LLVDVNHIPLQPMFLTTTIAVVYF 636 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -2 Query: 307 KYRASSSSRSCFPFGINSSRCLNSEHTL 224 K + S R+C P N+ CL + TL Sbjct: 6 KQEVNLSRRACRPTTTNNDDCLQEQRTL 33 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.2 bits (50), Expect = 3.9 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = +2 Query: 539 IFANKA-RLEKKKYTLH--PGHTDYMDRFLEEQEASG 640 IFA+ A R KY LH PG + +DRF+ Q+ +G Sbjct: 2060 IFASLAVRHGFHKYFLHLSPGLQEVIDRFVRIQQENG 2096 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 23.4 bits (48), Expect = 6.8 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 374 WSLCRNAFPSQGFLCI 327 +SLC N+FP LC+ Sbjct: 249 YSLCTNSFPLGTLLCV 264 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 747,670 Number of Sequences: 2352 Number of extensions: 15563 Number of successful extensions: 28 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -