BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20954 (669 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g33040.1 68415.m04052 ATP synthase gamma chain, mitochondrial... 85 4e-17 At4g04640.1 68417.m00679 ATP synthase gamma chain 1, chloroplast... 32 0.40 At3g21760.1 68416.m02745 UDP-glucoronosyl/UDP-glucosyl transfera... 31 0.52 At1g07240.1 68414.m00770 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.2 At4g15280.1 68417.m02340 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.6 At4g15260.1 68417.m02338 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.6 At1g07250.1 68414.m00771 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.6 At1g07260.1 68414.m00772 UDP-glucoronosyl/UDP-glucosyl transfera... 29 2.1 At3g21790.1 68416.m02748 UDP-glucoronosyl/UDP-glucosyl transfera... 29 2.8 At2g29730.1 68415.m03613 UDP-glucoronosyl/UDP-glucosyl transfera... 28 4.9 At2g29710.1 68415.m03611 UDP-glucoronosyl/UDP-glucosyl transfera... 28 4.9 At4g01380.1 68417.m00178 plastocyanin-like domain-containing pro... 28 6.5 At3g21780.1 68416.m02747 UDP-glucoronosyl/UDP-glucosyl transfera... 28 6.5 At2g39720.1 68415.m04874 zinc finger (C3HC4-type RING finger) fa... 28 6.5 At5g62580.1 68418.m07855 expressed protein 27 8.5 >At2g33040.1 68415.m04052 ATP synthase gamma chain, mitochondrial (ATPC) identical to SP|Q96250 ATP synthase gamma chain, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; contains Pfam profile: PF00231 ATP synthase Length = 325 Score = 85.0 bits (201), Expect = 4e-17 Identities = 55/158 (34%), Positives = 89/158 (56%), Gaps = 11/158 (6%) Frame = +3 Query: 228 EHQGDLCGRKSRGILQRLYGKHIISVANEIGRLPPTFLDASQLATAILTSGYEFGSGKII 407 E Q + G K++ I+ R I+ E+ + P + S LA IL + EF + +I+ Sbjct: 141 EVQFVIVGEKAKAIMFRDSKNDIVLSVTELNKNPLNYAQVSVLADDILKN-VEFDALRIV 199 Query: 408 YNKFKSVVSYAQSDLAPLH*EVY*ERQQADG-IRLLDS----------DVLQSYTEFSLA 554 YNKF SVV++ + L E+ + + G + LDS ++LQ+ EF + Sbjct: 200 YNKFHSVVAFLPTVSTVLSPEIIEKESEIGGKLGELDSYEIEGGETKGEILQNLAEFQFS 259 Query: 555 SLLFYALKEGACSEQSSRMTAMDNASKSAGEMIDKLTL 668 ++F A+ E ACSE +RM+AMD++S++AGEM+D+LTL Sbjct: 260 CVMFNAVLENACSEMGARMSAMDSSSRNAGEMLDRLTL 297 >At4g04640.1 68417.m00679 ATP synthase gamma chain 1, chloroplast (ATPC1) identical to SP|Q01908 ATP synthase gamma chain 1, chloroplast precursor (EC 3.6.3.14) {Arabidopsis thaliana} Length = 373 Score = 31.9 bits (69), Expect = 0.40 Identities = 23/75 (30%), Positives = 32/75 (42%), Gaps = 11/75 (14%) Frame = +2 Query: 2 KMVSAAKYTRAERDLKAARPYGEGAVQFYERAEVTPPEDD-----------PKQLFVAMT 148 K+V+AAK RA+ + RP+ E V+ DD K V +T Sbjct: 74 KLVAAAKVRRAQEAVVNGRPFSETLVEVLYNINEQLQTDDVDVPLTKVRPVKKVALVVVT 133 Query: 149 SDRGLCGVYTLVYLK 193 DRGLCG + +K Sbjct: 134 GDRGLCGGFNNFIIK 148 >At3g21760.1 68416.m02745 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 485 Score = 31.5 bits (68), Expect = 0.52 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 412 TSSSLWYRTPSPTWPLYTKKSIES 483 T SLW+ P TWPLY ++ + + Sbjct: 377 TLESLWFGVPMATWPLYAEQQVNA 400 >At1g07240.1 68414.m00770 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 480 Score = 30.3 bits (65), Expect = 1.2 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 421 SLWYRTPSPTWPLYTKKSIES 483 SLWY P TWP+Y ++ + + Sbjct: 375 SLWYGVPIATWPMYAEQQLNA 395 >At4g15280.1 68417.m02340 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 478 Score = 29.9 bits (64), Expect = 1.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 421 SLWYRTPSPTWPLYTKKSIES 483 SLW+ P TWPLY ++ + + Sbjct: 373 SLWFGVPMVTWPLYAEQKVNA 393 >At4g15260.1 68417.m02338 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 359 Score = 29.9 bits (64), Expect = 1.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 421 SLWYRTPSPTWPLYTKKSIES 483 SLW+ P TWPLY ++ + + Sbjct: 253 SLWFGVPMVTWPLYAEQKVNA 273 >At1g07250.1 68414.m00771 UDP-glucoronosyl/UDP-glucosyl transferase family protein similar to UDP-glucose glucosyltransferase GI:453245 from [Manihot esculenta] Length = 479 Score = 29.9 bits (64), Expect = 1.6 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 412 TSSSLWYRTPSPTWPLYTKKSIES 483 T SLW+ P TWP+Y ++ + + Sbjct: 373 TLESLWFGVPVATWPMYAEQQLNA 396 >At1g07260.1 68414.m00772 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 476 Score = 29.5 bits (63), Expect = 2.1 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +1 Query: 421 SLWYRTPSPTWPLYTKKSIESAS 489 SLW+ P TWP+Y ++ + + S Sbjct: 375 SLWFGVPIATWPMYAEQQLNAFS 397 >At3g21790.1 68416.m02748 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 495 Score = 29.1 bits (62), Expect = 2.8 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 412 TSSSLWYRTPSPTWPLYTKKSIES 483 T SLW+ P+ WPLY ++ + Sbjct: 374 TLESLWFGVPTAAWPLYAEQKFNA 397 >At2g29730.1 68415.m03613 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 467 Score = 28.3 bits (60), Expect = 4.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +1 Query: 421 SLWYRTPSPTWPLYTKKSIES 483 SLW+ P TWP+Y ++ + + Sbjct: 365 SLWFGVPIVTWPMYAEQQLNA 385 >At2g29710.1 68415.m03611 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 467 Score = 28.3 bits (60), Expect = 4.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +1 Query: 421 SLWYRTPSPTWPLYTKKSIES 483 SLW+ P TWP+Y ++ + + Sbjct: 365 SLWFGVPIVTWPMYAEQQLNA 385 >At4g01380.1 68417.m00178 plastocyanin-like domain-containing protein Length = 210 Score = 27.9 bits (59), Expect = 6.5 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +2 Query: 332 YFLGRKSVGHCHSHLRIRV 388 YF+ K+ GHC++ L++RV Sbjct: 152 YFISSKTPGHCYAGLKLRV 170 >At3g21780.1 68416.m02747 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 431 Score = 27.9 bits (59), Expect = 6.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 412 TSSSLWYRTPSPTWPLYTKKSIES 483 T SLW+ P WPLY ++ + Sbjct: 317 TLESLWFGVPMAIWPLYAEQKFNA 340 >At2g39720.1 68415.m04874 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 401 Score = 27.9 bits (59), Expect = 6.5 Identities = 23/66 (34%), Positives = 34/66 (51%) Frame = +1 Query: 358 PLPFSPQDTSLVPERSFITSSSLWYRTPSPTWPLYTKKSIESASKLTAYDFWTATYSNPT 537 PL F+P D SF T+++ +R+P+ P + S SAS + A + T T T Sbjct: 37 PLDFTPSD-------SFTTTTTTQHRSPTRFPPPSSSSSTPSAS-MHADNSPTPTIVTRT 88 Query: 538 RSSRWP 555 RS+R P Sbjct: 89 RSNRSP 94 >At5g62580.1 68418.m07855 expressed protein Length = 615 Score = 27.5 bits (58), Expect = 8.5 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = -2 Query: 455 GQVGLGVRYHRLELVINDLSGTKLVS*G--ENGSGQLTC 345 G GL R H LEL ++++S VS G NGS + C Sbjct: 486 GMRGLETRVHGLELALDEISYDLAVSNGRMSNGSSRNNC 524 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,095,464 Number of Sequences: 28952 Number of extensions: 303089 Number of successful extensions: 892 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 874 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 890 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -