BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20953 (650 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y17688-1|CAA76813.1| 153|Anopheles gambiae gSG1 protein protein. 28 0.29 AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. 28 0.29 >Y17688-1|CAA76813.1| 153|Anopheles gambiae gSG1 protein protein. Length = 153 Score = 27.9 bits (59), Expect = 0.29 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Frame = +2 Query: 353 QDYEKFMH----FLDEEQQRIKLRALEKEIIKKWLSARTTKPITINRWSTNTYV 502 QD E +H + + QQR+ + E ++ +A K I +N+W + YV Sbjct: 65 QDGELLVHPPEPYFSDCQQRLDSAKRDAEADRRAFTAEMQKKIQVNQWEADRYV 118 >AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. Length = 401 Score = 27.9 bits (59), Expect = 0.29 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Frame = +2 Query: 353 QDYEKFMH----FLDEEQQRIKLRALEKEIIKKWLSARTTKPITINRWSTNTYV 502 QD E +H + + QQR+ + E ++ +A K I +N+W + YV Sbjct: 65 QDGELLVHPPEPYFSDCQQRLDSAKRDAEADRRAFTAEMQKKIQVNQWEADRYV 118 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 744,471 Number of Sequences: 2352 Number of extensions: 16198 Number of successful extensions: 122 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -