BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20951 (426 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC839.05c |rps1701|rps17-1|40S ribosomal protein S17|Schizosac... 101 4e-23 SPCC24B10.09 |rps1702|rps17-2, rps17|40S ribosomal protein S17|S... 101 4e-23 SPCC162.08c |nup211||nuclear pore complex associated protein|Sch... 28 0.53 SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyce... 27 0.92 SPCC1827.04 |||ankyrin repeat protein, unknown biological role|S... 27 1.2 SPAC1039.04 |||nicotinic acid plasma membrane transporter |Schiz... 27 1.2 SPAC1B3.09c |||Noc2p-Noc3p complex subunit Noc2 family |Schizosa... 25 3.7 SPCC1442.06 |||20S proteasome component alpha 2|Schizosaccharomy... 25 6.5 SPBC1D7.05 |byr2|ste8, SPBC2F12.01|MAP kinase kinase kinase Byr2... 24 8.6 SPBC609.03 |||WD repeat protein, human IQWD1 family|Schizosaccha... 24 8.6 >SPBC839.05c |rps1701|rps17-1|40S ribosomal protein S17|Schizosaccharomyces pombe|chr 2|||Manual Length = 131 Score = 101 bits (243), Expect = 4e-23 Identities = 47/65 (72%), Positives = 55/65 (84%) Frame = +3 Query: 60 IEKYYTRLTLDFDTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEE 239 IEKYY RLTLDF TNKRI +E+AII +K LRNKIAG+ THLM+R++ VRGIS KLQEE Sbjct: 17 IEKYYPRLTLDFQTNKRIVDEVAIIASKRLRNKIAGYTTHLMKRIQRGPVRGISFKLQEE 76 Query: 240 ERERR 254 ERER+ Sbjct: 77 ERERK 81 Score = 44.4 bits (100), Expect = 8e-06 Identities = 23/42 (54%), Positives = 29/42 (69%) Frame = +2 Query: 260 YVPEVSALEHDIIEVDPDTKDMLKMLDFNNINGLQLTQPATQ 385 YVPEVS LE D + VD DTKDMLK L ++ I +++ PA Q Sbjct: 84 YVPEVSELEVDRVNVDQDTKDMLKSLGYDQI-PVRVLAPAPQ 124 >SPCC24B10.09 |rps1702|rps17-2, rps17|40S ribosomal protein S17|Schizosaccharomyces pombe|chr 3|||Manual Length = 132 Score = 101 bits (243), Expect = 4e-23 Identities = 47/65 (72%), Positives = 55/65 (84%) Frame = +3 Query: 60 IEKYYTRLTLDFDTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEE 239 IEKYY RLTLDF TNKRI +E+AII +K LRNKIAG+ THLM+R++ VRGIS KLQEE Sbjct: 17 IEKYYPRLTLDFQTNKRIVDEVAIIASKRLRNKIAGYTTHLMKRIQRGPVRGISFKLQEE 76 Query: 240 ERERR 254 ERER+ Sbjct: 77 ERERK 81 Score = 44.8 bits (101), Expect = 6e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = +2 Query: 260 YVPEVSALEHDIIEVDPDTKDMLKMLDFNNI 352 YVPEVS LE D I VD DTKDMLK L +++I Sbjct: 84 YVPEVSELEKDKINVDQDTKDMLKALGYDSI 114 >SPCC162.08c |nup211||nuclear pore complex associated protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1837 Score = 28.3 bits (60), Expect = 0.53 Identities = 19/66 (28%), Positives = 34/66 (51%) Frame = +3 Query: 96 DTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEEERERRTTMSQKC 275 D K + ++I II K L++ +A +TH + L+H+Q S++ E ++ T Sbjct: 145 DKEKEVEKKITII--KDLKDALAS-STHQVLELQHTQQEKASLQTNYEFELQKLTQKNSI 201 Query: 276 LLSNMT 293 L +N T Sbjct: 202 LENNNT 207 >SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 604 Score = 27.5 bits (58), Expect = 0.92 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +3 Query: 186 RRLRHSQVRGISIKLQEEERERRTTMSQKCLLSNMTS 296 R+ S+ R S KL EEER+RRT + L + +TS Sbjct: 218 RKRSRSRPRERSSKLSEEERDRRTVFVSQ-LANRLTS 253 >SPCC1827.04 |||ankyrin repeat protein, unknown biological role|Schizosaccharomyces pombe|chr 3|||Manual Length = 600 Score = 27.1 bits (57), Expect = 1.2 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 201 SQVRGISIKLQEEERERRTTMSQKCLLSNM 290 S V ISIK QEEER+R+ + ++ S + Sbjct: 351 SHVDSISIKAQEEERKRQAEIEKEIRQSRL 380 >SPAC1039.04 |||nicotinic acid plasma membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 507 Score = 27.1 bits (57), Expect = 1.2 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = -3 Query: 148 RGLVGMIAISSHILLFVSKSSVNLV*YFSIIIFAAFL 38 RG+V + AIS+ ++ F+ S++++ + + FA FL Sbjct: 352 RGIVLIAAISTTMIGFIVYGSIDIMNHIGVSYFACFL 388 >SPAC1B3.09c |||Noc2p-Noc3p complex subunit Noc2 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 528 Score = 25.4 bits (53), Expect = 3.7 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 166 PAILFLRGLVGMIAISSHILLFVSK 92 P I LRGLV A H+L F++K Sbjct: 457 PIIAQLRGLVNESAPGKHVLTFLNK 481 >SPCC1442.06 |||20S proteasome component alpha 2|Schizosaccharomyces pombe|chr 3|||Manual Length = 245 Score = 24.6 bits (51), Expect = 6.5 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 120 EIAIIPTKPLRNKIAGFATHLMRRLRHSQVR 212 EIA++ TKP + I G RL S++R Sbjct: 209 EIAVVSTKPTDSGIVGVPGGHFCRLSQSEIR 239 >SPBC1D7.05 |byr2|ste8, SPBC2F12.01|MAP kinase kinase kinase Byr2|Schizosaccharomyces pombe|chr 2|||Manual Length = 659 Score = 24.2 bits (50), Expect = 8.6 Identities = 11/42 (26%), Positives = 18/42 (42%) Frame = +2 Query: 185 EASQTLASARNLYQTSGRGA*EAYNYVPEVSALEHDIIEVDP 310 + S T+ LYQ++G YN E + H ++ P Sbjct: 316 QKSITMVGVEPLYQSNGNEKSSKYNVFSESAHGNHQVLSFSP 357 >SPBC609.03 |||WD repeat protein, human IQWD1 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 809 Score = 24.2 bits (50), Expect = 8.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 248 EAYNYVPEVSALEHDI 295 E YNY+P+ + L H I Sbjct: 408 ENYNYIPDSNGLNHSI 423 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,622,530 Number of Sequences: 5004 Number of extensions: 29560 Number of successful extensions: 89 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 152416050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -