BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20951 (426 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein ... 129 5e-32 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 23 3.4 >AF164153-1|AAD47077.1| 131|Anopheles gambiae ribosomal protein S17 protein. Length = 131 Score = 129 bits (311), Expect = 5e-32 Identities = 60/65 (92%), Positives = 63/65 (96%) Frame = +3 Query: 60 IEKYYTRLTLDFDTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEE 239 IEKYYTRLT+DFDTNKRI EE+AIIPTKPLRNKIAGF THLM+RLRHSQVRGISIKLQEE Sbjct: 17 IEKYYTRLTMDFDTNKRIVEEVAIIPTKPLRNKIAGFVTHLMKRLRHSQVRGISIKLQEE 76 Query: 240 ERERR 254 ERERR Sbjct: 77 ERERR 81 Score = 64.1 bits (149), Expect = 2e-12 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 257 NYVPEVSALEHDIIEVDPDTKDMLKMLDFNNINGLQLTQP 376 NYVP+VSALE DIIEVDP+TK+MLK LDFNNI +QLT P Sbjct: 83 NYVPDVSALEQDIIEVDPETKEMLKHLDFNNI-VVQLTNP 121 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.4 bits (48), Expect = 3.4 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 290 DIIEVDPDTKDMLKMLDFNNINGL 361 DI +VDPD L + NNI G+ Sbjct: 636 DIEDVDPDLHRSLTWILENNITGI 659 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 397,605 Number of Sequences: 2352 Number of extensions: 7285 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 34867302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -