BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20945 (713 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 26 0.26 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 22 4.3 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 22 5.7 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 22 5.7 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 5.7 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 5.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 5.7 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 21 7.5 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 21 7.5 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 21 7.5 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 7.5 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 9.9 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 26.2 bits (55), Expect = 0.26 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = +2 Query: 20 LTCLFYVFKLHIVVCC 67 L C++Y + +H++ CC Sbjct: 255 LVCIYYFYYMHLLFCC 270 Score = 24.6 bits (51), Expect = 0.81 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +2 Query: 26 CLFYVFKLHIVVCC 67 C F +F +H++ CC Sbjct: 171 CAFIIFTMHLLFCC 184 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 22.2 bits (45), Expect = 4.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 713 PFKFGGSFSPVRFKILA 663 P KF GS+ R+ ILA Sbjct: 129 PMKFSGSWKRARYLILA 145 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 362 LDADEHRSVSQKYGVTGFPTIKIFTG 439 +DA ++ YGV GF I FTG Sbjct: 279 IDAGMSGPYTKGYGVMGFNEICEFTG 304 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.8 bits (44), Expect = 5.7 Identities = 12/50 (24%), Positives = 28/50 (56%) Frame = -2 Query: 316 IFGNKAFTMSTPRCKELNDPNSSEFVTNLSKLLGVSSITSEDES*RAKDP 167 IF + AF ++ ++ NDP+ +E+V +L+ ++ ++ + R + P Sbjct: 40 IFFDDAFIRTS---EDDNDPHVNEYVESLASIIDEAATKVHGTTVRVRPP 86 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.8 bits (44), Expect = 5.7 Identities = 12/50 (24%), Positives = 28/50 (56%) Frame = -2 Query: 316 IFGNKAFTMSTPRCKELNDPNSSEFVTNLSKLLGVSSITSEDES*RAKDP 167 IF + AF ++ ++ NDP+ +E+V +L+ ++ ++ + R + P Sbjct: 354 IFFDDAFIRTS---EDDNDPHVNEYVESLASIIDEAATKVHGTTVRVRPP 400 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 5.7 Identities = 12/50 (24%), Positives = 28/50 (56%) Frame = -2 Query: 316 IFGNKAFTMSTPRCKELNDPNSSEFVTNLSKLLGVSSITSEDES*RAKDP 167 IF + AF ++ ++ NDP+ +E+V +L+ ++ ++ + R + P Sbjct: 587 IFFDDAFIRTS---EDDNDPHVNEYVESLASIIDEAATKVHGTTVRVRPP 633 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 5.7 Identities = 12/50 (24%), Positives = 28/50 (56%) Frame = -2 Query: 316 IFGNKAFTMSTPRCKELNDPNSSEFVTNLSKLLGVSSITSEDES*RAKDP 167 IF + AF ++ ++ NDP+ +E+V +L+ ++ ++ + R + P Sbjct: 587 IFFDDAFIRTS---EDDNDPHVNEYVESLASIIDEAATKVHGTTVRVRPP 633 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 21.4 bits (43), Expect = 7.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 540 FLAEIFICLLLAAFKAAS 487 FLA I +CL+L A +S Sbjct: 2 FLAPIILCLVLLALLVSS 19 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.4 bits (43), Expect = 7.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 540 FLAEIFICLLLAAFKAAS 487 FLA I +CL+L A +S Sbjct: 2 FLAPIILCLVLLALLVSS 19 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.4 bits (43), Expect = 7.5 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 Query: 163 QRGPWPSTIRLQTLSS 210 +RGP ST+R Q +SS Sbjct: 113 ERGPRNSTLRRQQMSS 128 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.4 bits (43), Expect = 7.5 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 Query: 163 QRGPWPSTIRLQTLSS 210 +RGP ST+R Q +SS Sbjct: 113 ERGPRNSTLRRQQMSS 128 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.0 bits (42), Expect = 9.9 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +2 Query: 38 VFKLHIVVCCESRSQKFYNRLF 103 +F L V CC++ F ++F Sbjct: 154 IFNLVYVYCCDNNFNVFLRQVF 175 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,121 Number of Sequences: 336 Number of extensions: 3619 Number of successful extensions: 14 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18947110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -