BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20944 (754 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 22 5.4 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 22 5.4 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 22 5.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 7.1 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 605 NHRLAVDHAADKKHIKSLCSNID 673 NH + A K ++KSL SN D Sbjct: 249 NHEKMLREQAKKMNVKSLVSNQD 271 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 605 NHRLAVDHAADKKHIKSLCSNID 673 NH + A K ++KSL SN D Sbjct: 249 NHEKMLREQAKKMNVKSLVSNQD 271 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 642 NTLSHYAQTLTLWRPNAKNYKRL 710 +T + ++QT W P +NYK L Sbjct: 431 STSAGFSQTNKTWLPVNENYKSL 453 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +1 Query: 25 ARNACAATSPTKPRSLDTQLAYIEQPFDTDIER 123 ARN A S T+ + +I +P D +ER Sbjct: 687 ARNLAAEVSHTQRLVVHVPPRWIVEPTDVSVER 719 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,915 Number of Sequences: 438 Number of extensions: 4151 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -