BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20942 (682 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6B12.16 |meu26||conserved fungal protein|Schizosaccharomyces... 27 3.3 SPAC7D4.11c |sec39||secretory pathway protein Sec39 |Schizosacch... 26 5.8 SPAPB1A10.09 |ase1||microtubule-associated protein Ase1 |Schizos... 25 7.7 SPMIT.08 |||mitochondrial ribosomal small subunit|Schizosaccharo... 25 7.7 >SPAC6B12.16 |meu26||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 344 Score = 26.6 bits (56), Expect = 3.3 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +1 Query: 448 IYLLNSVRKDISMSNNMFYLTRCYS 522 IYL N++ ++ N++FY +C+S Sbjct: 10 IYLNNTLLSEVPEPNSVFYTPKCFS 34 >SPAC7D4.11c |sec39||secretory pathway protein Sec39 |Schizosaccharomyces pombe|chr 1|||Manual Length = 769 Score = 25.8 bits (54), Expect = 5.8 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 9 SINYNFILKKSILINEKDIFITVHNNIFKWST 104 S N++F+ KK + + + D VH + W+T Sbjct: 222 SENWDFVWKKLLQLVKTDGLAVVHTLVLNWNT 253 >SPAPB1A10.09 |ase1||microtubule-associated protein Ase1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 731 Score = 25.4 bits (53), Expect = 7.7 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +2 Query: 374 NIRSPKNKY-SVVKRNNHCESNDLHP 448 N +P NK+ + V RN H ES HP Sbjct: 594 NSNTPFNKFPNSVSRNTHFESKSPHP 619 >SPMIT.08 |||mitochondrial ribosomal small subunit|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 227 Score = 25.4 bits (53), Expect = 7.7 Identities = 11/36 (30%), Positives = 23/36 (63%) Frame = +1 Query: 424 LRKQRSSPIYLLNSVRKDISMSNNMFYLTRCYSFVL 531 L K +P + N ++K ++SN++ Y ++ YSF++ Sbjct: 65 LNKNYPNPSIISNIIQK--ALSNHLLYSSKNYSFIV 98 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,788,547 Number of Sequences: 5004 Number of extensions: 56987 Number of successful extensions: 127 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -