BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20941 (729 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0792 - 28091597-28091675,28091853-28091908,28092151-280922... 32 0.54 11_04_0079 - 13284869-13284929,13285518-13285639,13285749-132858... 30 2.2 04_03_0558 + 17111138-17111996,17112474-17112564,17112647-171132... 28 8.7 >04_04_0792 - 28091597-28091675,28091853-28091908,28092151-28092211, 28092290-28092363,28092865-28092945,28093127-28093201, 28093276-28093395,28093486-28093566,28093644-28093712, 28094057-28094128,28094220-28094362,28094452-28094566, 28094651-28094774,28095124-28095476,28096035-28096374, 28096914-28097124,28097209-28097482,28097570-28097788, 28097868-28098004,28098117-28098375 Length = 980 Score = 31.9 bits (69), Expect = 0.54 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = -3 Query: 193 NLASIVSWNILSSSYGSDHFPIVINFPIATSSRTKCRSPRMKFKLENANWFSFK 32 N+ SI+S + + D F + I+ P ++ + MK K +ANWF K Sbjct: 561 NVTSIISEAVQREGHQVDEFSLEISLPAVIAANDRAIRLYMKEKYGSANWFDEK 614 >11_04_0079 - 13284869-13284929,13285518-13285639,13285749-13285820, 13286048-13286200,13289510-13289709,13289745-13289947, 13289991-13290181 Length = 333 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +1 Query: 556 SATPPYPSDLSSRIQEYLGILKLKPGRSQVSCKEIKKRLIFIC*IDNVT 702 S P + S ++E LGILK +P R + C L + DNVT Sbjct: 217 SLIPKFESMDRKILKEELGILKHRPPRPSIQCVSYSNYLSYFWANDNVT 265 >04_03_0558 + 17111138-17111996,17112474-17112564,17112647-17113268, 17113378-17113457,17113871-17113937,17114138-17114263, 17114333-17114415,17115334-17115777,17115834-17115927, 17116038-17116124,17116474-17116594,17116671-17116709, 17116828-17116997 Length = 960 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -1 Query: 261 GKELVAHNPMKKSVPLIFQSVLLI*LLSFPGIFYLLVMVAIIF 133 GKE++ NP KS P++ + L + IFY ++ ++F Sbjct: 764 GKEMIPINPRAKSTPMVKKFSL---RTEYTAIFYSWALIILVF 803 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,912,042 Number of Sequences: 37544 Number of extensions: 326951 Number of successful extensions: 717 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 707 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 717 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -