BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20941 (729 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF100669-1|AAK39265.1| 931|Caenorhabditis elegans Hypothetical ... 48 9e-06 Z78536-1|CAB01715.2| 417|Caenorhabditis elegans Hypothetical pr... 31 1.1 U39850-10|AAA81060.2| 439|Caenorhabditis elegans Hypothetical p... 30 1.5 Z81513-3|CAB04185.3| 476|Caenorhabditis elegans Hypothetical pr... 29 4.5 Z49889-6|CAA90069.2| 435|Caenorhabditis elegans Hypothetical pr... 29 4.5 Z49887-7|CAA90060.2| 435|Caenorhabditis elegans Hypothetical pr... 29 4.5 U41543-6|AAB37023.1| 2018|Caenorhabditis elegans Hypothetical pr... 28 7.9 >AF100669-1|AAK39265.1| 931|Caenorhabditis elegans Hypothetical protein R11E3.3 protein. Length = 931 Score = 47.6 bits (108), Expect = 9e-06 Identities = 25/72 (34%), Positives = 39/72 (54%) Frame = -3 Query: 226 ISAPDLSICTPNLASIVSWNILSSSYGSDHFPIVINFPIATSSRTKCRSPRMKFKLENAN 47 IS+PD++ICT +LA+ W+ L GSDH P+ + + T R R+ + AN Sbjct: 86 ISSPDITICTADLATKCHWSTL-YKLGSDHIPMKLKI---NQAATPKRPKRLVANFKKAN 141 Query: 46 WFSFKEEVEKVI 11 W F++ +E I Sbjct: 142 WQLFRDHIESRI 153 Score = 28.3 bits (60), Expect = 5.9 Identities = 21/61 (34%), Positives = 34/61 (55%), Gaps = 5/61 (8%) Frame = -1 Query: 456 SLYIP-HPTSSVYNEIESIFS-IFP--NPILIMGDFNAQHVAWGSSIS-NHYGSRLLDMV 292 ++Y+P +SS + + + FS IF + +I GD NA H AW S S + G L +++ Sbjct: 5 NVYVPPRSSSSNHARLMTDFSNIFQTKSKSIISGDVNAHHSAWHSEGSEDTRGRELAELI 64 Query: 291 D 289 D Sbjct: 65 D 65 >Z78536-1|CAB01715.2| 417|Caenorhabditis elegans Hypothetical protein C07A4.2 protein. Length = 417 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = +3 Query: 165 IFQETIEARLGVQIERSGALISSWGCVRRVPYQYLKYTIYTYRPYPTVESHNDY 326 I++ + + +GV I +S ++ S CV P Y Y + Y P ESH Y Sbjct: 357 IWKNSRKIGVGVSIVKSSSIRSP--CVSSSPNMYFIYVVVKYDPAGNFESHKAY 408 >U39850-10|AAA81060.2| 439|Caenorhabditis elegans Hypothetical protein F52C9.3 protein. Length = 439 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = +2 Query: 194 RSTD*KIRGTDFFMGLCA--TSSLPVFKIHHLYLSTISNSRE 313 RSTD K GTDF A S+LP + IH LY+S+ + ++ Sbjct: 370 RSTDEKFYGTDFLANSVAFKISALPSY-IHRLYISSNATPKD 410 >Z81513-3|CAB04185.3| 476|Caenorhabditis elegans Hypothetical protein F26D2.3a protein. Length = 476 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/46 (28%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -2 Query: 671 NLFLISLQETWLRPGFNFRIPKYSCI-REDRSDGYGGVALLIKNNI 537 N+F++ + E++ G N + Y+C+ R + S G+G + LL +++ Sbjct: 188 NVFVLPVTESYDSKGHNINLAHYNCMKRLEASRGWGYLMLLQNHDV 233 >Z49889-6|CAA90069.2| 435|Caenorhabditis elegans Hypothetical protein T06H11.4 protein. Length = 435 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/50 (36%), Positives = 28/50 (56%) Frame = -1 Query: 363 FNAQHVAWGSSISNHYGSRLLDMVDKYKWCILNTGKELVAHNPMKKSVPL 214 F AQ + I N +G R + + K +++TG ELV +PM ++VPL Sbjct: 165 FEAQIGSAEFGILNAFGIRTIKVYKKPVVTVISTGSELV--SPMVENVPL 212 >Z49887-7|CAA90060.2| 435|Caenorhabditis elegans Hypothetical protein T06H11.4 protein. Length = 435 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/50 (36%), Positives = 28/50 (56%) Frame = -1 Query: 363 FNAQHVAWGSSISNHYGSRLLDMVDKYKWCILNTGKELVAHNPMKKSVPL 214 F AQ + I N +G R + + K +++TG ELV +PM ++VPL Sbjct: 165 FEAQIGSAEFGILNAFGIRTIKVYKKPVVTVISTGSELV--SPMVENVPL 212 >U41543-6|AAB37023.1| 2018|Caenorhabditis elegans Hypothetical protein F46H5.4 protein. Length = 2018 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +1 Query: 538 ILFLMRSATPPYPSDLSSRIQEYLG-ILKL 624 +LFL+ A PPY +LS + EY+G +LKL Sbjct: 816 LLFLI--ANPPYSDELSMKAFEYIGELLKL 843 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,292,620 Number of Sequences: 27780 Number of extensions: 309114 Number of successful extensions: 776 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 756 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 775 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1718929214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -