BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20934 (658 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT025841-1|ABF85741.1| 256|Drosophila melanogaster IP12016p pro... 29 7.3 BT001632-1|AAN71387.1| 739|Drosophila melanogaster RE38584p pro... 29 7.3 AY060980-1|AAL28528.1| 237|Drosophila melanogaster GM13219p pro... 28 9.7 AE014297-4073|AAF56670.2| 381|Drosophila melanogaster CG5880-PA... 28 9.7 >BT025841-1|ABF85741.1| 256|Drosophila melanogaster IP12016p protein. Length = 256 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -3 Query: 563 INSNQYVSGSIPNLSPLHTIVHYSVLMSVCCL 468 + S++ V G L P+H I+ Y S+C L Sbjct: 163 VRSSEQVRGEHKELPPVHPIIRYKTGQSICSL 194 >BT001632-1|AAN71387.1| 739|Drosophila melanogaster RE38584p protein. Length = 739 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +2 Query: 275 RIDTSEPQ-KIDLPEGTHIIGRGKFIVNDAEDMRVSRNHAEIEVTDT 412 RI+ P+ P G ++ G V D D R +NH +IE T T Sbjct: 602 RINERSPRISCACPTGLKLMVDGLMCVEDLADQRPVKNHTQIEKTTT 648 >AY060980-1|AAL28528.1| 237|Drosophila melanogaster GM13219p protein. Length = 237 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -2 Query: 648 SQLVGYFFIISWSTIACNIIFHHI 577 SQLV YF +I + + N++FH++ Sbjct: 93 SQLVTYFLLIVGNWLLLNVVFHYV 116 >AE014297-4073|AAF56670.2| 381|Drosophila melanogaster CG5880-PA protein. Length = 381 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -2 Query: 648 SQLVGYFFIISWSTIACNIIFHHI 577 SQLV YF +I + + N++FH++ Sbjct: 93 SQLVTYFLLIVGNWLLLNVVFHYV 116 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,590,389 Number of Sequences: 53049 Number of extensions: 567404 Number of successful extensions: 1136 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1135 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2806815600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -