BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20932 (587 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 3.9 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 5.1 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 5.1 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 5.1 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 3.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 241 RGSYPSHRLQRQVRRPRSGLAPRVRDRHL 327 RG HR P S L +V++RHL Sbjct: 1057 RGEMSVHRAGSYYGVPHSTLEYKVKERHL 1085 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 460 IGAQDTVALPNVGSSGRDKCSY 525 I QDTV + N+ SG++ Y Sbjct: 189 IEEQDTVLVVNIEKSGKESKKY 210 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.8 bits (44), Expect = 5.1 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 220 RRWSCRSRGSYPSHRLQRQVRRPRSGLAPRVRDR 321 +R+SC S++ + R+ R R RDR Sbjct: 270 KRYSCSREREQKSYKNENSYRKYRETSKERSRDR 303 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/31 (25%), Positives = 16/31 (51%) Frame = +3 Query: 60 PIQPPCLVPPEMMAAQSKLVYQMNKFYNERV 152 P PP P +MM + + ++QM + + + Sbjct: 52 PGAPPSQNPSQMMISPASGIHQMQQLLQQHI 82 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,273 Number of Sequences: 438 Number of extensions: 3364 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17115420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -