BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20930 (798 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced prot... 22 5.7 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 5.7 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 7.6 >AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced protein 75 protein. Length = 87 Score = 22.2 bits (45), Expect = 5.7 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -2 Query: 314 LNKNRCLYCHV 282 +N+NRC YC + Sbjct: 66 INRNRCQYCRL 76 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.2 bits (45), Expect = 5.7 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -2 Query: 314 LNKNRCLYCHV 282 +N+NRC YC + Sbjct: 115 INRNRCQYCRL 125 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.8 bits (44), Expect = 7.6 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 702 PYKLSNLLFVTESLTLIAGAFKSPSRNILYK 610 P L N T+ L G+F R+++YK Sbjct: 131 PMNLENFPMDTQRCPLQFGSFGYTKRDVIYK 161 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 225,823 Number of Sequences: 438 Number of extensions: 5065 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25246416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -