BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20928 (691 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 3.1 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 3.1 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 22 5.4 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 9.5 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 22.6 bits (46), Expect = 3.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 137 GRDXDRVHEDRRGLYLH 87 G+D VH RRGL LH Sbjct: 14 GQDKHMVHWFRRGLRLH 30 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 22.6 bits (46), Expect = 3.1 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -2 Query: 477 RQLSKDNSASNGSGDFLAALHTQTNMTVVVANGNK 373 ++ K NS +NGS D + ++ + NG+K Sbjct: 275 KEKDKPNSTTNGSPDVIKVEPELSDSEKTLCNGSK 309 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.8 bits (44), Expect = 5.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 498 TSSNW*NRQLSKDNSASNGSGD 433 T+S+ R + NSASN SGD Sbjct: 335 TASSKNYRSATGGNSASNSSGD 356 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +1 Query: 586 PLVVLELCLRQFLRSFFR 639 PL+V+E C R L+++ R Sbjct: 528 PLLVVEYCSRGDLQTYLR 545 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,998 Number of Sequences: 336 Number of extensions: 3428 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -