BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20928 (691 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 26 0.97 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 26 1.3 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 26 1.3 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 25 1.7 AY146749-1|AAO12064.1| 336|Anopheles gambiae odorant-binding pr... 25 3.0 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 24 3.9 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 24 3.9 AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical prote... 24 3.9 AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosens... 24 3.9 AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding pr... 24 5.2 AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding pr... 24 5.2 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 24 5.2 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 23 6.9 DQ370047-1|ABD18608.1| 89|Anopheles gambiae putative secreted ... 23 6.9 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 6.9 AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CY... 23 9.1 AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CY... 23 9.1 AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CY... 23 9.1 AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CY... 23 9.1 AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CY... 23 9.1 AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CY... 23 9.1 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 23 9.1 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 23 9.1 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 23 9.1 AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14... 23 9.1 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 26.2 bits (55), Expect = 0.97 Identities = 24/100 (24%), Positives = 38/100 (38%) Frame = +3 Query: 318 DHACTETNTCRTAHTFQGICCHWRQQRSYWFGCEVQQGSRHCHSRRYYPC*VVCFTSSKR 497 DHA T TC+T + G+ H + F E + H R Y +C +R Sbjct: 1805 DHAVTRCTTCQTVF-WIGLRKHHCRSCGQIFCAECSDYTAHLPEERLYQPVRLCGPCYQR 1863 Query: 498 LLGYKIGKPHTVPCKVTGKCGSVTVRLIPAPRGTGIVSAP 617 + + P T TG GS + + A + + + P Sbjct: 1864 ISSMTV--PATSSVSTTG--GSSSTMVSSAVSNSAVATGP 1899 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 25.8 bits (54), Expect = 1.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 Query: 563 CNSPADSCPSWYWNC 607 C +P SCP YW C Sbjct: 877 CRTPVMSCPQDYWLC 891 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 25.8 bits (54), Expect = 1.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 Query: 563 CNSPADSCPSWYWNC 607 C +P SCP YW C Sbjct: 877 CRTPVMSCPQDYWLC 891 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 25.4 bits (53), Expect = 1.7 Identities = 22/85 (25%), Positives = 31/85 (36%) Frame = +3 Query: 318 DHACTETNTCRTAHTFQGICCHWRQQRSYWFGCEVQQGSRHCHSRRYYPC*VVCFTSSKR 497 DHA T TC+T + G+ H + F E + H R Y +C +R Sbjct: 1806 DHAVTRCTTCQTVF-WIGLRKHHCRSCGQIFCAECSDYTAHLPEERLYQPVRLCGPCYQR 1864 Query: 498 LLGYKIGKPHTVPCKVTGKCGSVTV 572 + + P T TG S V Sbjct: 1865 ISSMTV--PATSSVSTTGGSSSTMV 1887 >AY146749-1|AAO12064.1| 336|Anopheles gambiae odorant-binding protein AgamOBP38 protein. Length = 336 Score = 24.6 bits (51), Expect = 3.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 572 PADSCPSWYWNCVCAS 619 PADSC YW+ C S Sbjct: 118 PADSCAGAYWSFRCYS 133 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -3 Query: 635 KKLLRNWRRHNSSTTRGRNQPDCYRTTLAGDLA 537 K + + RR++SS+ + ++ D TTL D A Sbjct: 15 KTTISSSRRYSSSSYQDQSMDDALNTTLTNDKA 47 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -3 Query: 635 KKLLRNWRRHNSSTTRGRNQPDCYRTTLAGDLA 537 K + + RR++SS+ + ++ D TTL D A Sbjct: 15 KTTISSSRRYSSSSYQDQSMDDALNTTLTNDKA 47 >AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical protein protein. Length = 191 Score = 24.2 bits (50), Expect = 3.9 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = +2 Query: 323 CLYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCLFYQFEE 496 CL K P + +LP A T AR SP+ E L +++ L+Y + + Sbjct: 53 CLLSRKPCPPEGKDLKRILPEALRT-------KCARCSPIQKENALKIITRLYYDYPD 103 >AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosensory protein CSP5 protein. Length = 191 Score = 24.2 bits (50), Expect = 3.9 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = +2 Query: 323 CLYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCLFYQFEE 496 CL K P + +LP A T AR SP+ E L +++ L+Y + + Sbjct: 53 CLLSRKPCPPEGKDLKRILPEALRT-------KCARCSPIQKENALKIITRLYYDYPD 103 >AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding protein AgamOBP50 protein. Length = 166 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -1 Query: 604 IPVPRGAGISRTVTEPHLPVTLQGTVCGFPILY 506 + +P +T+ E + QGTVC F Y Sbjct: 35 LTLPTYGNCLQTIAEKYPDALWQGTVCAFDCTY 67 >AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding protein OBPjj6b protein. Length = 315 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -1 Query: 604 IPVPRGAGISRTVTEPHLPVTLQGTVCGFPILY 506 + +P +T+ E + QGTVC F Y Sbjct: 184 LTLPTYGNCLQTIAEKYPDALWQGTVCAFDCTY 216 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 390 QQRSYWFGCEVQQGSRHCHSRR 455 ++R+YW+ E+ Q HC R Sbjct: 268 RRRAYWWTTEIAQCRSHCIEAR 289 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 23.4 bits (48), Expect = 6.9 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -3 Query: 623 RNWRRHNSSTTRGRNQPDCYR 561 + W H +T R P CYR Sbjct: 27 QGWYMHGRNTLRQMRWPPCYR 47 >DQ370047-1|ABD18608.1| 89|Anopheles gambiae putative secreted peptide protein. Length = 89 Score = 23.4 bits (48), Expect = 6.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 534 GRCVAFRSCTPVTSS 490 G+C+A CTPV S Sbjct: 68 GKCIAADQCTPVPES 82 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.4 bits (48), Expect = 6.9 Identities = 12/53 (22%), Positives = 19/53 (35%) Frame = -2 Query: 510 CTPVTSSNW*NRQLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCAL 352 CT + R K + + +F + Q T +A N+C C L Sbjct: 658 CTVTEDGRYTGRYCEKCPTCAGRCNEFKHCVQCQQYKTGPLAEANECATNCTL 710 >AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 9.1 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 333 LYRHDL*NLIIQGRAEE 283 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 9.1 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 333 LYRHDL*NLIIQGRAEE 283 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 9.1 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 333 LYRHDL*NLIIQGRAEE 283 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 9.1 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 333 LYRHDL*NLIIQGRAEE 283 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 9.1 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 333 LYRHDL*NLIIQGRAEE 283 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 9.1 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 333 LYRHDL*NLIIQGRAEE 283 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 262 EFEIIDFFLGPSLNDEVLKIMPV 330 + E ID F G L+ + LKI P+ Sbjct: 29 KLEYIDLFKGGHLSSDYLKINPL 51 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 179 EPTLSGLPCRAHDHGRDXDRVHEDRRGL 96 EP SG +A D G+ +R H+ +GL Sbjct: 315 EPGRSGEKGQAGDRGQVGERGHKGEKGL 342 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 23.0 bits (47), Expect = 9.1 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 333 LYRHDL*NLIIQGRAEE 283 + RHD+ NL++Q R +E Sbjct: 275 IVRHDMINLLMQARKQE 291 >AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14D protein. Length = 360 Score = 23.0 bits (47), Expect = 9.1 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 534 GRCVAFRSCTPV 499 G+CV FR C P+ Sbjct: 39 GKCVLFRECQPL 50 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 744,873 Number of Sequences: 2352 Number of extensions: 15280 Number of successful extensions: 54 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -