BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20924 (809 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 23 2.5 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 22 5.8 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 5.8 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 23.4 bits (48), Expect = 2.5 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -1 Query: 737 GMTGLRLASASRACCRPNALRIRSAFTKEL*TWNLSRIHADVTSSRASTRS 585 G+ GL ++ + + C P A + +K S A TSS AS+R+ Sbjct: 142 GLHGLSSSAPTGSSCGPGAAAAAALLSKRRSVSECSLGTASSTSSTASSRN 192 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 22.2 bits (45), Expect = 5.8 Identities = 12/33 (36%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = -2 Query: 325 GAFYGTFGYLSSVFF---IIQRYCRFCLSSDAF 236 G G F FF I+ YC+ C+S AF Sbjct: 275 GVIMGVFLICWVPFFCVNIVTSYCKTCISGRAF 307 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.2 bits (45), Expect = 5.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 261 RQYLWIMKKTLLRYPKVP*NAP*N 332 R+YL ++K RY P NAP N Sbjct: 447 RRYLPVLKNFPTRYIHEPWNAPLN 470 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 220,439 Number of Sequences: 438 Number of extensions: 5151 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25731924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -