BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20922 (691 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52275| Best HMM Match : CTF_NFI (HMM E-Value=0.86) 29 3.6 SB_21583| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_1652| Best HMM Match : Keratin_B2 (HMM E-Value=0.031) 28 8.2 >SB_52275| Best HMM Match : CTF_NFI (HMM E-Value=0.86) Length = 809 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +3 Query: 393 MSTGLPFNATFNYMRRLPIDAPAQHADDSMDPLDVPQGRLLHNAPPD 533 MSTG P NA+ Y R + A Q + M+ RL H + P+ Sbjct: 456 MSTGFPSNASLQYQRMMHSQASQQALYNRMNAQQNMSQRLSHPSIPE 502 >SB_21583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 294 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 384 TCLCRGYYPMSRSHICCNLHLLDKSLSNLPSPSSRTMPVEDLMTA 250 TCLC + + H C H++ P PS TM + DL+T+ Sbjct: 191 TCLCSHSNTLPKYHNCIGGHIIG-CFDPYPDPSQFTM-IRDLVTS 233 >SB_1652| Best HMM Match : Keratin_B2 (HMM E-Value=0.031) Length = 563 Score = 27.9 bits (59), Expect = 8.2 Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 2/65 (3%) Frame = -2 Query: 558 LVMTCSVPCRAVRCGAVF--LVVRLEGPCCHQHAGQEHRWAVSACS*KSH*MADRCSSTK 385 +V+ C+V CRAV C V +V CC AVS C+ + R S + Sbjct: 333 VVLCCAVLCRAVSCRVVLCCVVPCCVVLCCAVSCRAVLCRAVSCCAVLCRAVLCRAVSCR 392 Query: 384 TCLCR 370 LCR Sbjct: 393 AVLCR 397 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,546,400 Number of Sequences: 59808 Number of extensions: 504720 Number of successful extensions: 1241 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1077 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1236 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -