BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20917 (769 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 3.6 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 22 4.7 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 22 4.7 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 22 4.7 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 6.2 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 6.2 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 139 DKKNRCTCGLSPV 101 D KNRC CG P+ Sbjct: 2667 DFKNRCGCGKHPL 2679 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 22.2 bits (45), Expect = 4.7 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = -3 Query: 515 QNCEFSQRLPENMHTRLLIFQLQFLTQRTIMLLVRILFLKLSILLDIALRTQN 357 Q C P H L + L + + L I+F SILL+I RT+N Sbjct: 202 QQCVTYNVFPTYAHE--LTYLLFGMVMMYALPLAVIIFSYASILLEIRRRTRN 252 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 22.2 bits (45), Expect = 4.7 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = -3 Query: 515 QNCEFSQRLPENMHTRLLIFQLQFLTQRTIMLLVRILFLKLSILLDIALRTQN 357 Q C P H L + L + + L I+F SILL+I RT+N Sbjct: 202 QQCVTYNVFPTYAHE--LTYLLFGMVMMYALPLAVIIFSYASILLEIRRRTRN 252 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 22.2 bits (45), Expect = 4.7 Identities = 13/50 (26%), Positives = 23/50 (46%) Frame = +1 Query: 307 GNDWIWYIRFPSFSIGVFWVRSAMSNNMDSFRNNILTRSIIVR*VRNCSW 456 G WI Y+R I F + + ++DS ++ SII+ ++ W Sbjct: 56 GTCWIIYVRIYCKEIRFFEISFEILGSLDSLILLMVLVSIILGSLKTKEW 105 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +1 Query: 307 GNDWIWYIRFPSFSIGVFWVRS 372 GN W+ Y S I + W++S Sbjct: 339 GNQWVGYEDPESVQIKMDWIKS 360 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.8 bits (44), Expect = 6.2 Identities = 5/9 (55%), Positives = 7/9 (77%) Frame = -2 Query: 642 WMYINGNWL 616 W Y+NG W+ Sbjct: 88 WKYVNGEWV 96 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,647 Number of Sequences: 336 Number of extensions: 4047 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20650031 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -